Lus10020609 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09270 100 / 7e-29 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004877 171 / 7e-57 AT5G09270 105 / 1e-30 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G066900 119 / 5e-36 AT5G09270 120 / 1e-36 unknown protein
Potri.007G102600 108 / 6e-32 AT5G09270 107 / 1e-31 unknown protein
PFAM info
Representative CDS sequence
>Lus10020609 pacid=23172379 polypeptide=Lus10020609 locus=Lus10020609.g ID=Lus10020609.BGIv1.0 annot-version=v1.0
ATGGCAACAGAAGAGAAAGGAGATGGTGAGCAGCAGACCGCAAGTCCTGCAGCCACCAATTTTGGCGGAAGAGTGGTGGACCAGTACCGAAAGCTCAAAG
AACATGCAGAAGCTTACCCTTACGTGTGGGGTTCATACATTGTCGTGTACGGTGGTTTTGGCCTCTATTTAGCCTACCGAGTGAGGAAACTCCGCCAAAC
TGAGGACAGAGTTCGAGCCCTGCAGGAGAGACTTCGCAAACTTGCTAAGGAGCCAGTTGCATCTTCATCCATGGCATCAACTTCTTCTGCAACAGCACCA
TCATCGTCGACCAATACACCGTCCAAGTAG
AA sequence
>Lus10020609 pacid=23172379 polypeptide=Lus10020609 locus=Lus10020609.g ID=Lus10020609.BGIv1.0 annot-version=v1.0
MATEEKGDGEQQTASPAATNFGGRVVDQYRKLKEHAEAYPYVWGSYIVVYGGFGLYLAYRVRKLRQTEDRVRALQERLRKLAKEPVASSSMASTSSATAP
SSSTNTPSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09270 unknown protein Lus10020609 0 1
AT3G10120 unknown protein Lus10017035 12.5 0.8692
AT1G04610 YUC3 YUCCA 3 (.1) Lus10023695 34.6 0.8423
AT1G08125 S-adenosyl-L-methionine-depend... Lus10021425 39.6 0.8356
AT5G03310 SAUR-like auxin-responsive pro... Lus10037990 39.8 0.8089
AT1G32400 TOM2A tobamovirus multiplication 2A ... Lus10030939 43.7 0.8314
AT2G34560 P-loop containing nucleoside t... Lus10023310 50.1 0.8372
AT2G32235 unknown protein Lus10008093 53.4 0.7803
AT1G79390 unknown protein Lus10001759 64.2 0.8300
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023492 64.8 0.8301
Lus10034649 99.4 0.8181

Lus10020609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.