Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27730 96 / 1e-26 copper ion binding (.1) AT5G04750 47 / 1e-07 F1F0-ATPase inhibitor protein, putative (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004865 [exp] 186 / 2e-61 AT2G27730 112 / 3e-32 copper ion binding (.1) Lus10034146 [exp] 45 / 7e-07 AT5G04750 80 / 8e-21 F1F0-ATPase inhibitor protein, putative (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G163100 [exp] 120 / 2e-36 AT2G27730 96 / 1e-26 copper ion binding (.1) Potri.004G201700 [exp] 93 / 2e-25 AT2G27730 60 / 1e-12 copper ion binding (.1) Potri.008G016801 [exp] 49 / 1e-08 AT5G04750 56 / 8e-12 F1F0-ATPase inhibitor protein, putative (.1.2) Potri.010G240401 [exp] 43 / 2e-06 AT5G04750 57 / 3e-12 F1F0-ATPase inhibitor protein, putative (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020624 pacid=23172268 polypeptide=Lus10020624 locus=Lus10020624.g ID=Lus10020624.BGIv1.0 annot-version=v1.0 ATGGCAACTAGGATGTCTGCACTGAGGTACATTAGCAAGAGGTTCTCCAGCAGCGGTAAGGTGCTGAGCGAGGAGGAGAAAGCTGCTGAGAACATCTACA TCAAGAAAATGGAGCAAGAGAAGCTAGAGAAGCTCGCCCGTAAGGACCCCAAGCCAGAGGCTGCACCAAGCTCCGGAGCTCCAGTAACAGAAGCCACTCC CTCAGCTTCAGGAGGTTCCACTGCCTCAACTGAGAAGACCTCAACCGACAAGTACCGCAACTACGCAGTAGTGACCGGAGTCGTCACTATTTTCGCCTCT CTCGGGTGGTACCTCAAGGGCGGTTCGAAGAAGCAAGAGGCCCAGGAGTAA
AA sequence Show only first row Show all	>Lus10020624 pacid=23172268 polypeptide=Lus10020624 locus=Lus10020624.g ID=Lus10020624.BGIv1.0 annot-version=v1.0 MATRMSALRYISKRFSSSGKVLSEEEKAAENIYIKKMEQEKLEKLARKDPKPEAAPSSGAPVTEATPSASGGSTASTEKTSTDKYRNYAVVTGVVTIFAS LGWYLKGGSKKQEAQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27730			copper ion binding (.1)		Lus10020624 [exp]	0	1
AT1G53850		PAE1, ATPAE1	ARABIDOPSIS 20S PROTEASOME ALP...		Lus10037454 [exp]	5.2	0.9278
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Lus10025329 [exp]	5.7	0.9002
AT4G21900		PRORP3	proteinaceous RNase P 3 (.1)		Lus10043379 [exp]	5.8	0.8982
AT2G15430		NRPE3A, NRPD3, ...	DNA-directed RNA polymerase fa...		Lus10002823 [exp]	6.0	0.9186
AT3G15010			RNA-binding (RRM/RBD/RNP motif...		Lus10023817 [exp]	7.5	0.9213
AT2G03190		ASK16	SKP1-like 16 (.1)		Lus10031747 [exp]	11.2	0.9061
AT3G06790			plastid developmental protein ...		Lus10016825 [exp]	12.0	0.9148
AT1G70350			unknown protein		Lus10029157 [exp]	12.8	0.8734
AT1G27090			glycine-rich protein (.1)		Lus10037224 [exp]	13.9	0.9218
AT5G19950			Domain of unknown function (DU...		Lus10019397 [exp]	14.5	0.8920

Compare expression of checked genes

Lus10020624 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.