Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09560 45 / 1e-06 GLP5 germin-like protein 5 (.1) AT3G05950 45 / 1e-06 RmlC-like cupins superfamily protein (.1) AT1G18970 45 / 1e-06 GLP4 germin-like protein 4 (.1) AT3G04200 42 / 8e-06 RmlC-like cupins superfamily protein (.1) AT5G38960 42 / 1e-05 RmlC-like cupins superfamily protein (.1) AT1G02335 41 / 2e-05 GL22 germin-like protein subfamily 2 member 2 precursor (.1) AT1G18980 41 / 3e-05 RmlC-like cupins superfamily protein (.1) AT3G05930 41 / 3e-05 GLP8 germin-like protein 8 (.1) AT5G38930 40 / 7e-05 RmlC-like cupins superfamily protein (.1) AT5G38950 39 / 8e-05 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004858 [exp] 94 / 4e-25 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004856 [exp] 70 / 5e-16 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004855 [exp] 68 / 3e-15 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10020632 [exp] 66 / 1e-14 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10020631 [exp] 63 / 2e-13 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1) Lus10004854 [exp] 61 / 2e-12 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004857 [exp] 60 / 2e-12 AT1G02335 140 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1) Lus10034191 [exp] 59 / 8e-12 AT1G18970 136 / 4e-40 germin-like protein 4 (.1) Lus10043393 [exp] 55 / 1e-10 AT1G18970 123 / 3e-35 germin-like protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G194600 [exp] 70 / 6e-16 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2) Potri.009G157100 [exp] 68 / 3e-15 AT1G09560 105 / 3e-28 germin-like protein 5 (.1) Potri.008G084300 [exp] 65 / 4e-14 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1) Potri.013G116500 [exp] 64 / 4e-14 AT1G18970 70 / 1e-14 germin-like protein 4 (.1) Potri.010G240700 [exp] 64 / 6e-14 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1) Potri.008G016700 [exp] 62 / 4e-13 AT1G18980 122 / 6e-35 RmlC-like cupins superfamily protein (.1) Potri.010G240500 [exp] 60 / 3e-12 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1) Potri.010G240600 [exp] 58 / 1e-11 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2) Potri.019G026200 [exp] 44 / 4e-06 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Potri.013G051800 [exp] 43 / 4e-06 AT3G05950 245 / 8e-83 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020630 pacid=23172389 polypeptide=Lus10020630 locus=Lus10020630.g ID=Lus10020630.BGIv1.0 annot-version=v1.0 ATGGCGGTATGGTGTGATTCGGGTTTGAGCGGGGACGGGAGGCTAGGGTTTCGAAGGGCCAAAGGGCTTGTTCATTTCCAGTACTTAAACAAGAAGAACC CTGGCAGTGGTGGGGAGTTTGCTTTTGCTGTTTTGGGGTTCGGGAGCGCGAATCCAGGCACTGTTTCGGTTGGTAAGAGCTTGTTTGGTGGTGAGATTGA TGATGAGGATGATGCCGTGTTGGCTAAGTCTTTCAAGACTGATGTTTGTACCATTCAAGCCCTCAAGGCTGCTATCAAGGGTTGA
AA sequence Show only first row Show all	>Lus10020630 pacid=23172389 polypeptide=Lus10020630 locus=Lus10020630.g ID=Lus10020630.BGIv1.0 annot-version=v1.0 MAVWCDSGLSGDGRLGFRRAKGLVHFQYLNKKNPGSGGEFAFAVLGFGSANPGTVSVGKSLFGGEIDDEDDAVLAKSFKTDVCTIQALKAAIKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020630 [exp]	0	1
AT5G22450			unknown protein		Lus10000530 [exp]	5.4	1.0000
					Lus10003536 [exp]	7.6	1.0000
					Lus10023589 [exp]	9.2	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	9.3	1.0000
					Lus10011078 [exp]	10.4	1.0000
					Lus10012998 [exp]	11.0	1.0000
					Lus10028667 [exp]	12.0	1.0000
					Lus10011425 [exp]	12.8	1.0000
AT2G20420			ATP citrate lyase (ACL) family...		Lus10022902 [exp]	13.2	1.0000
					Lus10027689 [exp]	15.3	1.0000

Compare expression of checked genes

Lus10020630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.