Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14103 57 / 2e-10 F-box/RNI-like superfamily protein (.1.2) AT2G42720 56 / 2e-10 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1) AT4G14096 55 / 7e-10 F-box/RNI-like superfamily protein (.1) AT3G26922 54 / 9e-10 F-box/RNI-like superfamily protein (.1) AT1G13570 54 / 1e-09 F-box/RNI-like superfamily protein (.1) AT1G19070 51 / 1e-09 F-box family protein (.1) AT3G58930 53 / 4e-09 F-box/RNI-like superfamily protein (.1) AT5G18780 52 / 5e-09 F-box/RNI-like superfamily protein (.1.2) AT5G56810 52 / 7e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G67390 52 / 7e-09 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020635 [exp] 238 / 5e-83 AT4G14103 57 / 1e-10 F-box/RNI-like superfamily protein (.1.2) Lus10004852 [exp] 92 / 1e-22 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1) Lus10004853 [exp] 88 / 8e-22 ND / Lus10011048 [exp] 86 / 1e-20 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1) Lus10004851 [exp] 82 / 2e-19 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1) Lus10029079 [exp] 69 / 8e-15 AT1G65440 1451 / 0.0 global transcription factor group B1 (.1.2.3) Lus10020636 [exp] 62 / 7e-14 AT5G56810 52 / 2e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10006342 [exp] 64 / 6e-13 AT5G51920 432 / 4e-144 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1) Lus10034415 [exp] 63 / 7e-13 AT1G13570 358 / 1e-123 F-box/RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G132400 [exp] 65 / 2e-13 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1) Potri.014G039700 [exp] 62 / 3e-12 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1) Potri.017G107600 [exp] 57 / 9e-11 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1) Potri.010G134200 [exp] 57 / 2e-10 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1) Potri.001G322900 [exp] 54 / 2e-09 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1) Potri.011G042900 [exp] 50 / 3e-08 AT1G61330 226 / 2e-68 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.014G163866 [exp] 50 / 5e-08 AT4G14103 79 / 2e-16 F-box/RNI-like superfamily protein (.1.2) Potri.013G151700 [exp] 49 / 1e-07 AT4G14096 87 / 2e-18 F-box/RNI-like superfamily protein (.1) Potri.013G146800 [exp] 47 / 3e-07 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1) Potri.001G337200 [exp] 47 / 5e-07 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10020634 pacid=23172313 polypeptide=Lus10020634 locus=Lus10020634.g ID=Lus10020634.BGIv1.0 annot-version=v1.0 ATGGAACCTGACAGAATCAGCAACTTGCCGGAAGATGTCAAAAAACATATACTGAACTTCTTACCGTTGAGGGATGCAGCAGAGTGCAGTGCCCTGTCAA CTGAATGGAAGGACTTATGGACTTATATCCCCAGTCTTTTCCTCGACATAGAGTTCGGAGCGAAAGGAAGGACCGAATCAAAACTAATGTCGGACATTTG CAGAGTTTTCCAGCTTCACCACGGACCTTTAAAACACTTCACTTTTTCGAAATGCTTCATGCTGTATGATAAGGCCAATCAGATCATGCAATTATTACTG TTGGGAATCAGCAGTTACAACTACCTCAAACCGGAAACTGGCTGA
AA sequence Show only first row Show all	>Lus10020634 pacid=23172313 polypeptide=Lus10020634 locus=Lus10020634.g ID=Lus10020634.BGIv1.0 annot-version=v1.0 MEPDRISNLPEDVKKHILNFLPLRDAAECSALSTEWKDLWTYIPSLFLDIEFGAKGRTESKLMSDICRVFQLHHGPLKHFTFSKCFMLYDKANQIMQLLL LGISSYNYLKPETG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020634 [exp]	0	1
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020635 [exp]	1.0	0.9264
AT5G56810			F-box/RNI-like/FBD-like domain...		Lus10020636 [exp]	1.4	0.8236
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Lus10020147 [exp]	3.2	0.7676
					Lus10015042 [exp]	3.5	0.7451
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Lus10020148 [exp]	3.9	0.7897
					Lus10002071 [exp]	5.3	0.7081
AT3G06240			F-box family protein (.1)		Lus10034007 [exp]	7.2	0.6868
AT1G08030		AQC1, TPST	active quiescent center1, tyro...		Lus10016093 [exp]	8.9	0.7715
AT1G72470		ATEXO70D1	exocyst subunit exo70 family p...		Lus10001112 [exp]	12.9	0.5685
					Lus10013650 [exp]	20.0	0.6937

Compare expression of checked genes

Lus10020634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.