Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56810 52 / 1e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) AT2G42720 50 / 6e-09 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1) AT5G27750 50 / 6e-09 F-box/FBD-like domains containing protein (.1) AT4G03220 50 / 7e-09 Protein with RNI-like/FBD-like domains (.1) AT5G54820 49 / 3e-08 F-box/RNI-like superfamily protein (.1) AT1G13780 48 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) AT3G59200 48 / 3e-08 F-box/RNI-like superfamily protein (.1) AT3G29830 48 / 4e-08 F-box/RNI-like superfamily protein (.1) AT5G18780 48 / 4e-08 F-box/RNI-like superfamily protein (.1.2) AT5G22660 47 / 5e-08 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004852 [exp] 106 / 7e-29 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1) Lus10011048 [exp] 76 / 5e-18 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1) Lus10004851 [exp] 70 / 7e-16 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1) Lus10020637 [exp] 66 / 4e-15 AT3G58940 47 / 3e-06 F-box/RNI-like superfamily protein (.1) Lus10020634 [exp] 61 / 1e-13 AT4G14103 57 / 1e-10 F-box/RNI-like superfamily protein (.1.2) Lus10020635 [exp] 61 / 1e-13 AT4G14103 57 / 1e-10 F-box/RNI-like superfamily protein (.1.2) Lus10004848 [exp] 61 / 3e-13 AT5G27750 50 / 1e-07 F-box/FBD-like domains containing protein (.1) Lus10026195 [exp] 59 / 7e-13 AT5G56810 55 / 2e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10029079 [exp] 58 / 1e-11 AT1G65440 1451 / 0.0 global transcription factor group B1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G039700 [exp] 49 / 1e-08 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1) Potri.001G322900 [exp] 49 / 3e-08 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1) Potri.014G163866 [exp] 48 / 3e-08 AT4G14103 79 / 2e-16 F-box/RNI-like superfamily protein (.1.2) Potri.017G107600 [exp] 48 / 4e-08 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1) Potri.002G132400 [exp] 47 / 7e-08 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1) Potri.015G011200 [exp] 47 / 8e-08 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.010G134200 [exp] 46 / 2e-07 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1) Potri.011G024200 [exp] 46 / 2e-07 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.001G395000 [exp] 46 / 2e-07 AT4G14103 89 / 4e-19 F-box/RNI-like superfamily protein (.1.2) Potri.011G121500 [exp] 46 / 2e-07 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10020636 pacid=23172293 polypeptide=Lus10020636 locus=Lus10020636.g ID=Lus10020636.BGIv1.0 annot-version=v1.0 ATGGCAAATGACGGCGGTGGTGCAGACAGAATCAGTAGCTTACCGAACAATGTCCGGCAGCATATCCTCATGTTCTTACCACTACGCGATGCAGCCAGGG TGAGCATCCTATCGACGAATTGGAAGAACATGTGCATGGATCTCCCTACACTTGTATTCGGCGAAAATTTTGAAACCAAGAAGAAAACTTGGTGGACAAG GTAA
AA sequence Show only first row Show all	>Lus10020636 pacid=23172293 polypeptide=Lus10020636 locus=Lus10020636.g ID=Lus10020636.BGIv1.0 annot-version=v1.0 MANDGGGADRISSLPNNVRQHILMFLPLRDAARVSILSTNWKNMCMDLPTLVFGENFETKKKTWWTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56810			F-box/RNI-like/FBD-like domain...		Lus10020636 [exp]	0	1
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020634 [exp]	1.4	0.8236
AT4G14103			F-box/RNI-like superfamily pro...		Lus10020635 [exp]	2.0	0.7843
					Lus10002071 [exp]	6.7	0.6816
					Lus10015042 [exp]	7.3	0.6748
AT5G62480		GST14B, ATGSTU9	GLUTATHIONE S-TRANSFERASE 14B,...		Lus10023595 [exp]	8.0	0.7157
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Lus10020147 [exp]	8.5	0.6775
AT1G05500		SYT5, NTMCTYPE2...	synaptotagmin 5, ARABIDOPSIS T...		Lus10027709 [exp]	8.9	0.6269
AT1G08030		AQC1, TPST	active quiescent center1, tyro...		Lus10016093 [exp]	10.1	0.7191
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Lus10016035 [exp]	17.7	0.6222
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10005190 [exp]	18.4	0.6719

Compare expression of checked genes

Lus10020636 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.