Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27700 151 / 7e-50 Ribosomal protein S21e (.1) AT3G53890 145 / 1e-47 Ribosomal protein S21e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015173 [exp] 168 / 3e-56 AT5G27700 151 / 1e-49 Ribosomal protein S21e (.1) Lus10010971 [exp] 138 / 7e-43 AT5G27700 128 / 7e-39 Ribosomal protein S21e (.1) Lus10031494 [exp] 97 / 2e-28 AT5G27700 89 / 2e-25 Ribosomal protein S21e (.1) Lus10029895 [exp] 0 / 1 AT5G27700 85 / 2e-32 Ribosomal protein S21e (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G017600 [exp] 158 / 2e-52 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1) Potri.005G026000 [exp] 158 / 2e-52 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01249 [flax] [poplar] Ribosomal_S21e Ribosomal protein S21e
Representative CDS sequence Show only first row Show all	>Lus10020645 pacid=23140807 polypeptide=Lus10020645 locus=Lus10020645.g ID=Lus10020645.BGIv1.0 annot-version=v1.0 ATGCAGAACGAAGAAGGTAACAACGTGGATCTCTACATCCCGAGGAAATGCTCCGCCACTAACAGGCTGATTACCTCGAAGGACCACGCCTCCGTCCAGA TCAATGTTGGACATTTGGACGCGAACGGCCGTTACACCGGCCAGTTCACCACCTTTGCTCTCTGTGGATTCGTCCGTGCTCAGGGTGATGGAGACAGCGG CCTTGACAGGCTGTGGCAGAAGAAGAAAGCCGAGCTCCGGCAATGA
AA sequence Show only first row Show all	>Lus10020645 pacid=23140807 polypeptide=Lus10020645 locus=Lus10020645.g ID=Lus10020645.BGIv1.0 annot-version=v1.0 MQNEEGNNVDLYIPRKCSATNRLITSKDHASVQINVGHLDANGRYTGQFTTFALCGFVRAQGDGDSGLDRLWQKKKAELRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27700			Ribosomal protein S21e (.1)		Lus10020645 [exp]	0	1
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10030200 [exp]	2.0	0.8751
AT5G60670			Ribosomal protein L11 family p...		Lus10026506 [exp]	2.4	0.8768
AT3G12150			unknown protein		Lus10035501 [exp]	4.6	0.8690
AT3G05560			Ribosomal L22e protein family ...		Lus10026555 [exp]	4.9	0.8325
AT4G11630			Ribosomal protein L19 family p...		Lus10041948 [exp]	5.2	0.7908
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	5.7	0.8674
AT2G09990			Ribosomal protein S5 domain 2-...		Lus10031970 [exp]	6.3	0.8614
AT1G60770			Tetratricopeptide repeat (TPR)...		Lus10013047 [exp]	6.7	0.8134
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	6.9	0.8271
AT5G24840			tRNA (guanine-N-7) methyltrans...		Lus10020164 [exp]	10.5	0.8284

Compare expression of checked genes

Lus10020645 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.