Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09130 139 / 1e-39 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT4G17040 89 / 9e-21 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G49970 83 / 3e-18 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) AT5G45390 69 / 2e-13 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G02560 57 / 2e-09 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G66670 56 / 8e-09 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029891 [exp] 367 / 6e-125 AT3G05510 255 / 1e-79 Phospholipid/glycerol acyltransferase family protein (.1.2) Lus10003953 [exp] 86 / 2e-19 AT1G49970 318 / 8e-107 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Lus10020990 [exp] 85 / 1e-18 AT1G49970 308 / 1e-102 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Lus10002422 [exp] 63 / 2e-11 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 62 / 8e-11 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10012156 [exp] 61 / 1e-10 AT5G45390 293 / 1e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10010003 [exp] 60 / 2e-10 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10007589 [exp] 60 / 2e-10 AT5G45390 293 / 2e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10025022 [exp] 60 / 3e-10 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G017166 [exp] 139 / 3e-39 AT1G09130 451 / 2e-159 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) Potri.009G089300 [exp] 93 / 1e-21 AT1G49970 459 / 7e-162 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Potri.003G083300 [exp] 88 / 4e-20 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1) Potri.001G295266 [exp] 72 / 2e-15 AT1G49970 306 / 5e-105 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Potri.007G071700 [exp] 67 / 7e-13 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.004G092100 [exp] 64 / 1e-11 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.003G103300 [exp] 59 / 3e-10 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.001G130601 [exp] 57 / 9e-10 AT5G45390 239 / 2e-79 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.002G195200 [exp] 57 / 2e-09 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 57 / 3e-09 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10020649 pacid=23140929 polypeptide=Lus10020649 locus=Lus10020649.g ID=Lus10020649.BGIv1.0 annot-version=v1.0 ATGGCTGTTTCTCTTCGAGTCCTCCCAAATCCCCCCTCCATCCCGCCCTCCGCCTTCAGTTCGTCTTCTCTCCGAAGGAGGAACATCAAGAACTTCAGCT GCTGCTGTACCGCCGCAGGAGGTTCCTCGGATTCCAAAGGAATGGATTCCTCTCTCTACATGCCTGATGGTTATTTCACCCCGCAGCTTGCTTCGCCCAA AGCCATTGGATCTATCTATGAAGCGGAGAAGTATCAACGTCAGATTCCGAGGAAGAACCGTAGTTTTCGATCTGTGAGAGTTGTCCGTATATGGATGCCT CTTGTACCAAAAGTCGTCGAGTTCATTCTTGGACAGCTGATGAAAATGGATTGGAAGGATCCCAAAGAACCTATTTATGTGCTTATAAACTCTACTGGGA CAACTCGTGAAGATGGCGAAGTAGTTGCGAGAGAGACACAAGGGTTCGCAGTCTATGATGCATTAATGACAATGCGATGCCCGATAACCACAATTGCTAT AGGTTTCGCATATGGCCACGCTGCTCTTTTGCTTGCTGCAGGAACAAAGGGAAGGCGGTTTTTGTTTCCAGATGCACAAATCGGTATCATGCATCCGCAA GTCGCACCTTCTGGTTTGATCCCGGCTGATTCTGTCGAAACCCGTTTAACTGAGGTTCTGTGGCGTGGGAACGAGACAAAGATGAAGTCAATGATTCCTC CAGAGGAATGGGACGATCATCTCAAGTTCGAAATCGATCCAAAGGGCAATTTCCCAATCTAG
AA sequence Show only first row Show all	>Lus10020649 pacid=23140929 polypeptide=Lus10020649 locus=Lus10020649.g ID=Lus10020649.BGIv1.0 annot-version=v1.0 MAVSLRVLPNPPSIPPSAFSSSSLRRRNIKNFSCCCTAAGGSSDSKGMDSSLYMPDGYFTPQLASPKAIGSIYEAEKYQRQIPRKNRSFRSVRVVRIWMP LVPKVVEFILGQLMKMDWKDPKEPIYVLINSTGTTREDGEVVARETQGFAVYDALMTMRCPITTIAIGFAYGHAALLLAAGTKGRRFLFPDAQIGIMHPQ VAPSGLIPADSVETRLTEVLWRGNETKMKSMIPPEEWDDHLKFEIDPKGNFPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09130			ATP-dependent caseinolytic (Cl...		Lus10020649 [exp]	0	1
AT5G46290		KAS1, KAS I, KA...	KETOACYL-ACP SYNTHASE 1, 3-ket...		Lus10040883 [exp]	1.4	0.9060
AT5G16620		PDE120, TIC40, ...	pigment defective embryo 120, ...		Lus10004053 [exp]	2.8	0.8922
AT3G03770			Leucine-rich repeat protein ki...		Lus10033407 [exp]	3.0	0.8695
AT1G72040			P-loop containing nucleoside t...		Lus10008257 [exp]	3.5	0.8936
AT1G11750		NCLPP6, NCLPP1,...	NUCLEAR-ENCODED CLPP 1, CLP pr...		Lus10040477 [exp]	3.9	0.8913
AT3G17830			Molecular chaperone Hsp40/DnaJ...		Lus10031336 [exp]	4.2	0.8856
AT2G44640			unknown protein		Lus10043347 [exp]	6.3	0.8972
AT1G06070	bZIP	AtbZIP69	Basic-leucine zipper (bZIP) tr...		Lus10008150 [exp]	7.4	0.8667
AT3G51140			Protein of unknown function (D...		Lus10041816 [exp]	8.5	0.8778
AT3G12110		ACT11	actin-11 (.1)		Lus10005163 [exp]	8.8	0.8610

Compare expression of checked genes

Lus10020649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.