Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05550 91 / 1e-25 Hypoxia-responsive family protein (.1) AT5G27760 82 / 4e-22 Hypoxia-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029883 [exp] 129 / 7e-39 AT3G05550 93 / 2e-24 Hypoxia-responsive family protein (.1) Lus10015191 [exp] 101 / 6e-30 AT3G05550 87 / 3e-24 Hypoxia-responsive family protein (.1) Lus10031490 [exp] 67 / 2e-16 AT3G05550 54 / 2e-11 Hypoxia-responsive family protein (.1) Lus10033002 [exp] 56 / 1e-11 AT3G05550 50 / 2e-09 Hypoxia-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G024500 [exp] 88 / 1e-24 AT5G27760 102 / 4e-30 Hypoxia-responsive family protein (.1) Potri.013G015400 [exp] 88 / 2e-24 AT3G05550 102 / 5e-30 Hypoxia-responsive family protein (.1) Potri.019G056000 [exp] 62 / 5e-14 AT3G05550 58 / 1e-12 Hypoxia-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04588 [flax] [poplar] HIG_1_N Hypoxia induced protein conserved region
Representative CDS sequence Show only first row Show all	>Lus10020658 pacid=23140901 polypeptide=Lus10020658 locus=Lus10020658.g ID=Lus10020658.BGIv1.0 annot-version=v1.0 ATGGCTGAAGGAAACAACACGTTCGAATCCATCAGGGAATGGGTCGCCGACCACAAGATGCGAACCGTCGGTGGGTTGTGGGCTAGCGCGATTGCTGGTT CGATTGCGTACAACTGGTCTCAACCCAACATGAAGACCAGCGTCAAGCTTATTCATGCCAGGATTCACGCCCAGGCGTTTACCCTGGCTGCTCTAGCAGG TGCTGCAGCTGTCGAATACTATGAACGTAACCATGCTGAAAAAGCAAAAGAAGCACATTGA
AA sequence Show only first row Show all	>Lus10020658 pacid=23140901 polypeptide=Lus10020658 locus=Lus10020658.g ID=Lus10020658.BGIv1.0 annot-version=v1.0 MAEGNNTFESIREWVADHKMRTVGGLWASAIAGSIAYNWSQPNMKTSVKLIHARIHAQAFTLAALAGAAAVEYYERNHAEKAKEAH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05550			Hypoxia-responsive family prot...		Lus10020658 [exp]	0	1
AT3G05550			Hypoxia-responsive family prot...		Lus10029883 [exp]	3.5	0.9771
AT1G58420			Uncharacterised conserved prot...		Lus10012496 [exp]	3.5	0.9699
AT4G31550	WRKY	ATWRKY11, WRKY1...	WRKY DNA-binding protein 11 (....		Lus10020136 [exp]	4.2	0.9649
AT2G37040		PAL1, ATPAL1	PHE ammonia lyase 1 (.1)		Lus10026518 [exp]	4.6	0.9658
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10039867 [exp]	8.0	0.9722
					Lus10037782 [exp]	9.2	0.9545
AT2G41640			Glycosyltransferase family 61 ...		Lus10031057 [exp]	10.6	0.9652
AT1G09090		ATRBOHB-BETA, A...	respiratory burst oxidase homo...		Lus10020644 [exp]	13.0	0.9710
AT1G09090		ATRBOHB-BETA, A...	respiratory burst oxidase homo...		Lus10029896 [exp]	15.3	0.9686
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10015208 [exp]	16.5	0.9553

Compare expression of checked genes

Lus10020658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.