Lus10020661 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G54070 58 / 9e-12 Dormancy/auxin associated family protein (.1)
AT1G28330 48 / 1e-07 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
AT5G44300 39 / 0.0002 Dormancy/auxin associated family protein (.1)
AT2G33830 37 / 0.0008 Dormancy/auxin associated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029881 174 / 3e-54 AT5G27830 245 / 9e-80 unknown protein
Lus10015193 147 / 2e-46 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10031488 143 / 6e-45 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10013180 59 / 2e-11 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10008142 56 / 1e-10 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10025446 48 / 5e-08 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Lus10013997 43 / 6e-06 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015418 43 / 6e-06 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013996 42 / 7e-06 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G014900 124 / 3e-37 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.005G024250 116 / 6e-35 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.003G070500 63 / 1e-13 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Potri.001G164800 59 / 5e-12 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.004G047100 49 / 7e-08 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Lus10020661 pacid=23140869 polypeptide=Lus10020661 locus=Lus10020661.g ID=Lus10020661.BGIv1.0 annot-version=v1.0
ATGGGACTGCTCGACCAGCTCTGGGACGACACAGTCGCCGGTCCGACCCCGGACAACGGCCTCGGCAAGCTACGGAAGTACAAAACTTTCAGCTTCCGAT
CAAACTCCGGCAAGGATTCCGATGGCGGGAATGTGAAATCGTACGGTAACGCGTCGGAGGAAGCAGCGACGAGAGTGACGCGAAGTATAATGATCGTTAA
GCCGCCGGGGTACCAGAGCGGATCTACCCCTCCTGTTTCCCCCGCCGGATCTACTCCTCCGGTGTCCCCATTTTCCGGAAACAGAGGACCGCCATCCCGG
TTCAGAAGGTGGTCAGCATCGGATGCATACGAGAAGGAGACCGTGGTGGCAGTCGTCGGAAGCCCGGTTGGATCAAGGAGCCCTGCTTCTCCTTACGACG
TCTGA
AA sequence
>Lus10020661 pacid=23140869 polypeptide=Lus10020661 locus=Lus10020661.g ID=Lus10020661.BGIv1.0 annot-version=v1.0
MGLLDQLWDDTVAGPTPDNGLGKLRKYKTFSFRSNSGKDSDGGNVKSYGNASEEAATRVTRSIMIVKPPGYQSGSTPPVSPAGSTPPVSPFSGNRGPPSR
FRRWSASDAYEKETVVAVVGSPVGSRSPASPYDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56220 Dormancy/auxin associated fami... Lus10020661 0 1
AT1G01470 LSR3, LEA14 LIGHT STRESS-REGULATED 3, LATE... Lus10001876 2.8 0.9193
AT5G02320 MYB MYB3R-5, ATMYB3... ARABIDOPSIS THALIANA MYB DOMAI... Lus10008010 4.2 0.9273
AT2G39210 Major facilitator superfamily ... Lus10021512 4.9 0.9355
AT5G63160 BT1 BTB and TAZ domain protein 1 (... Lus10033038 5.1 0.9275
Lus10036703 6.3 0.9221
AT5G47040 LON2 lon protease 2 (.1) Lus10001084 6.3 0.9243
Lus10027664 7.3 0.9218
AT3G50940 P-loop containing nucleoside t... Lus10015802 7.7 0.9065
AT5G47040 LON2 lon protease 2 (.1) Lus10040131 9.0 0.9166
AT3G19860 bHLH bHLH121 basic Helix-Loop-Helix 121, ba... Lus10028456 9.2 0.8554

Lus10020661 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.