Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46940 67 / 2e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 66 / 1e-13 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46930 59 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 55 / 5e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 53 / 3e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 47 / 7e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G02550 47 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 46 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 46 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 45 / 3e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029877 [exp] 293 / 5e-103 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10015199 [exp] 159 / 4e-50 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031483 [exp] 157 / 3e-49 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 62 / 3e-12 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 61 / 8e-12 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10000822 [exp] 57 / 2e-10 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10019498 [exp] 57 / 2e-10 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10002933 [exp] 55 / 8e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 55 / 1e-09 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G134900 [exp] 89 / 9e-23 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023201 [exp] 71 / 7e-15 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 71 / 8e-15 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.009G083500 [exp] 68 / 9e-15 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.003G086500 [exp] 67 / 5e-14 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 66 / 9e-14 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 67 / 1e-13 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 66 / 1e-13 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 64 / 2e-13 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G063000 [exp] 61 / 4e-12 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10020664 pacid=23140886 polypeptide=Lus10020664 locus=Lus10020664.g ID=Lus10020664.BGIv1.0 annot-version=v1.0 ATGGCGGCCAACAACAACCAACAACCCCTCCTAACCAAAGCCTGCGAGTCCACCCCACTCTACAAGGACCTCTGCATCTCGTCCCTAAGCACCTACCCTG AATCGGAGGTCAAAGACCTAAACGGCCTCGCCAAATACGCGATCGAGATGGTGTCCAAGAAGGCCGAGTTGACGCAGAAGCAGATTGTGGACATGGAGTC AAAGTCCGAGGACGAGGCCACCAAGAAGAAGCTCAACGACTGCGAAGAAATGTACGCCGACATCAGCGACACACTCAAGGAATCCGTGGAGTCTATGGAT AAGAAGGCTTACGACGACGCTATCGCGTCGTTGACTGCCGCGATGAATGATGTCGAAGCTTGTGAAGATGGGTTCAAAGAGCCTCCCGTCGTTAAGTCGC CGTTGACGGACGTTAATGAGATGTTTACTAAGTTCTGTAGCATTTGCTTGGCCATTACCAGCTCTGTTGACAAATAG
AA sequence Show only first row Show all	>Lus10020664 pacid=23140886 polypeptide=Lus10020664 locus=Lus10020664.g ID=Lus10020664.BGIv1.0 annot-version=v1.0 MAANNNQQPLLTKACESTPLYKDLCISSLSTYPESEVKDLNGLAKYAIEMVSKKAELTQKQIVDMESKSEDEATKKKLNDCEEMYADISDTLKESVESMD KKAYDDAIASLTAAMNDVEACEDGFKEPPVVKSPLTDVNEMFTKFCSICLAITSSVDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10020664 [exp]	0	1
AT5G19640			Major facilitator superfamily ...		Lus10039204 [exp]	21.2	0.7669
AT2G23440			unknown protein		Lus10009347 [exp]	44.4	0.7024
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10029814 [exp]	53.0	0.7305
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Lus10023627 [exp]	57.6	0.7520
AT1G23280			MAK16 protein-related (.1)		Lus10019648 [exp]	73.2	0.7497
AT1G65290		MTACP2	mitochondrial acyl carrier pro...		Lus10020221 [exp]	74.5	0.7321
AT3G06040			Ribosomal protein L12/ ATP-dep...		Lus10031180 [exp]	84.8	0.7486
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10000651 [exp]	93.3	0.7476
AT5G03310			SAUR-like auxin-responsive pro...		Lus10037990 [exp]	105.1	0.7376
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Lus10043158 [exp]	112.7	0.7236

Compare expression of checked genes

Lus10020664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.