Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27920 49 / 3e-08 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029869 [exp] 79 / 1e-18 AT5G27920 441 / 5e-150 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G013100 [exp] 58 / 2e-11 AT5G27920 631 / 0.0 F-box family protein (.1) Potri.005G022600 [exp] 56 / 1e-10 AT5G27920 626 / 0.0 F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020676 pacid=23140795 polypeptide=Lus10020676 locus=Lus10020676.g ID=Lus10020676.BGIv1.0 annot-version=v1.0 ATGGCAGGTGAAATTGAGCCAAAGCAACATCTCGGACGCGGCATTATCTTGGTGATGGGGAACTTGACGCGGCTGCAAGAGGCAAAACTCGTGCACCTAC CGAGCGTGACCATGAACGGGTGCGAGCTTGCGCTGAGGGCTTGCTGTGGCCGGATCAAGAAGGTGAAGTTGGTTAGTGAACTCAGGCTCTCTCTATCTTC GGAAGTGCTCGAGATATTGCGTCGCAAGGGTTGCATTGTTAGGTGGGACTAG
AA sequence Show only first row Show all	>Lus10020676 pacid=23140795 polypeptide=Lus10020676 locus=Lus10020676.g ID=Lus10020676.BGIv1.0 annot-version=v1.0 MAGEIEPKQHLGRGIILVMGNLTRLQEAKLVHLPSVTMNGCELALRACCGRIKKVKLVSELRLSLSSEVLEILRRKGCIVRWD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27920			F-box family protein (.1)		Lus10020676 [exp]	0	1
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10041188 [exp]	12.9	0.8909
AT4G34800			SAUR-like auxin-responsive pro...		Lus10007563 [exp]	17.8	0.8889
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10016179 [exp]	28.8	0.8029
AT5G45120			Eukaryotic aspartyl protease f...		Lus10018286 [exp]	36.7	0.8664
AT3G22830	HSF	AT-HSFA6B	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10039376 [exp]	37.0	0.8750
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10021266 [exp]	38.9	0.8578
AT2G20820			unknown protein		Lus10038583 [exp]	42.4	0.8082
AT5G45580	GARP		Homeodomain-like superfamily p...		Lus10012142 [exp]	48.7	0.8568
AT5G20110			Dynein light chain type 1 fami...		Lus10014484 [exp]	53.5	0.8610
AT2G02061			Nucleotide-diphospho-sugar tra...		Lus10031903 [exp]	54.4	0.8643

Compare expression of checked genes

Lus10020676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.