Lus10020678 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02330 137 / 3e-37 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G02810 127 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G47550 105 / 1e-25 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G04970 70 / 2e-13 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G10720 69 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
AT5G20740 59 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G62820 54 / 1e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G14300 54 / 2e-08 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
AT2G47670 53 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G14310 52 / 2e-07 ATPME3 pectin methylesterase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029867 493 / 3e-176 AT4G02330 352 / 3e-116 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10015210 270 / 1e-87 AT4G02330 556 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10031470 270 / 1e-87 AT4G02330 573 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10013416 118 / 2e-30 AT1G02810 519 / 2e-180 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10029866 100 / 6e-24 AT1G02810 511 / 6e-170 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10010309 91 / 8e-21 AT1G02810 575 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10013344 71 / 1e-13 AT3G14310 698 / 0.0 pectin methylesterase 3 (.1)
Lus10028882 64 / 2e-11 AT5G04970 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10031711 60 / 8e-11 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G022800 174 / 1e-50 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G127000 154 / 2e-43 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G202600 143 / 2e-39 AT1G02810 749 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G247700 87 / 3e-19 AT3G10720 746 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Potri.008G011100 82 / 2e-17 AT3G10720 744 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Potri.006G137800 58 / 4e-10 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G162400 53 / 5e-08 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Potri.018G051400 53 / 6e-08 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1)
Potri.003G072800 50 / 6e-07 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
Potri.006G134600 50 / 8e-07 AT2G26440 683 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10020678 pacid=23140930 polypeptide=Lus10020678 locus=Lus10020678.g ID=Lus10020678.BGIv1.0 annot-version=v1.0
ATGGCTGCTTCGAAGCTATTACCTTTCTCTCCCATTCTCTTACTCTTCATGTTCATCACCACTTCATCTCCTGCTACCTTACCAACAATTCCTCCCTCGA
CCAACAATGCAGCAGCCGCACCGGGGAACTTCTGCGCCACAACTCCATACCCTTCCTTCTGCAGATCGACTCTGCCTTACAACAAAACCAGCACAATCCA
CGACTACACTAGAAAATCCGTGAAGCAATCTCTGTCTCAATCCAGACAGTTCCTCCGCTTGATTAAGTATCTCCTCCGAACAGCCACCAAGTCCAAACCT
TTTCAGCAGCTCATCCCTTCACTTCTCGACTGCCGATTCCTAGCTCAGGTAAACGTGGACTCACTATCCAACACCATGAACACAATCAACTCCAAGGACA
ATCTTCCCAGCTTCCAAGCTAGTGACTTGCAGACCTTACTGAGTGCCACTTTAACAAATCTCGACACGTGTTTGGATGGGATTCGAGCTGCGGATTCCAG
CTCTACAGGGATCAACAACCTTGTAGCTCCTCTACTCAATGGCACCAAGTACTGCAGTGTTTCTCTTGCGCTTTTTGCTCACGGTTGGGTTCCCCCTCCG
AGGAGGAAGAATAAGGTTGGGAGAGTGCTTAGTGAAAGGCCGATTGAAGGGCATGTTCTTGCTGAATACAATCTTGACCGTGGATTTCCATTGCAAATGT
CGATCCAAGATCGTCGAGTTTTCGAGTCGTTTACAAGCAGAACCTGA
AA sequence
>Lus10020678 pacid=23140930 polypeptide=Lus10020678 locus=Lus10020678.g ID=Lus10020678.BGIv1.0 annot-version=v1.0
MAASKLLPFSPILLLFMFITTSSPATLPTIPPSTNNAAAAPGNFCATTPYPSFCRSTLPYNKTSTIHDYTRKSVKQSLSQSRQFLRLIKYLLRTATKSKP
FQQLIPSLLDCRFLAQVNVDSLSNTMNTINSKDNLPSFQASDLQTLLSATLTNLDTCLDGIRAADSSSTGINNLVAPLLNGTKYCSVSLALFAHGWVPPP
RRKNKVGRVLSERPIEGHVLAEYNLDRGFPLQMSIQDRRVFESFTSRT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02330 AtPME41, ATPMEP... pectin methylesterase 41, Plan... Lus10020678 0 1
AT4G02330 AtPME41, ATPMEP... pectin methylesterase 41, Plan... Lus10020679 1.0 0.9759
AT4G02330 AtPME41, ATPMEP... pectin methylesterase 41, Plan... Lus10029867 1.4 0.9224
AT2G47550 Plant invertase/pectin methyle... Lus10020680 5.5 0.9069
AT1G04640 LIP2 lipoyltransferase 2 (.1.2) Lus10031225 11.2 0.8452
AT1G70780 unknown protein Lus10019143 11.8 0.9095
AT5G48930 HCT hydroxycinnamoyl-CoA shikimate... Lus10010786 14.9 0.9221
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10013440 20.1 0.9078
AT3G57980 DNA-binding bromodomain-contai... Lus10031219 20.2 0.8795
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10029344 22.2 0.8858
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Lus10027573 25.5 0.8277

Lus10020678 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.