Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02810 167 / 1e-49 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G02330 165 / 8e-49 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G10720 155 / 9e-48 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) AT5G04970 162 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G47550 155 / 4e-45 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G23200 150 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G60730 145 / 1e-41 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G05620 142 / 1e-40 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G43270 140 / 5e-40 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G26440 140 / 6e-40 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029867 [exp] 248 / 2e-81 AT4G02330 352 / 3e-116 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10015210 [exp] 181 / 5e-55 AT4G02330 556 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10031470 [exp] 179 / 2e-54 AT4G02330 573 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10028882 [exp] 165 / 1e-48 AT5G04970 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008937 [exp] 164 / 3e-48 AT3G10720 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Lus10008203 [exp] 160 / 4e-47 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10010309 [exp] 158 / 1e-46 AT1G02810 575 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10029866 [exp] 159 / 1e-45 AT1G02810 511 / 6e-170 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10029868 [exp] 150 / 3e-43 AT3G05620 684 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G127000 [exp] 170 / 1e-50 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.002G202600 [exp] 169 / 1e-50 AT1G02810 749 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.005G022800 [exp] 169 / 2e-50 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.008G011100 [exp] 169 / 4e-50 AT3G10720 744 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Potri.010G247700 [exp] 166 / 2e-49 AT3G10720 746 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Potri.002G202500 [exp] 157 / 7e-46 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G126800 [exp] 153 / 1e-44 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.005G022700 [exp] 150 / 2e-43 AT3G05620 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.006G134600 [exp] 150 / 3e-43 AT2G26440 683 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.013G013200 [exp] 149 / 3e-43 AT3G05620 702 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10020679 pacid=23140856 polypeptide=Lus10020679 locus=Lus10020679.g ID=Lus10020679.BGIv1.0 annot-version=v1.0 ATGATCGGAGATGGAATCGGTAAGACTACCATCACTGGTAATCGAAGCGTCGTAGATGGATCCACCACCTTCAATTCCTCTACATTCGCTGTGAACGCAG CAGGATTCGTCGGCGTGGGGTTAACGTTCAGGAACACTGCCGGGCCGGTGAAGCATCAAGCTGTGGCGGTGAGAAATAGCGCCGACATGTCGGCGTTTTT CAACTGCAGCTTTGAAGGCTACCAAGATACACTATACGTCCATTCCCTCCGCCAGTTCTACCGCGACTGTGACATCTACGGCACCATAGACTACATCTTC GGGAACGCGGCCGTCGTGTTCCAGCACTGCCGACGCGGCCGTCGTGTTCCAGAACTGCCGGATGATGTCCAGGCTCCCTCTCCCCAACCAGTTCAACGCC ATCACAGCACAGGGAAGAACCGACCCGAACCAGAACACCGGGATCTCGATCCAGAACTGCAGCATTAA
AA sequence Show only first row Show all	>Lus10020679 pacid=23140856 polypeptide=Lus10020679 locus=Lus10020679.g ID=Lus10020679.BGIv1.0 annot-version=v1.0 MIGDGIGKTTITGNRSVVDGSTTFNSSTFAVNAAGFVGVGLTFRNTAGPVKHQAVAVRNSADMSAFFNCSFEGYQDTLYVHSLRQFYRDCDIYGTIDYIF GNAAVVFQHCRRGRRVPELPDDVQAPSPQPVQRHHSTGKNRPEPEHRDLDPELQH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10020679 [exp]	0	1
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10020678 [exp]	1.0	0.9759
AT2G47550			Plant invertase/pectin methyle...		Lus10020680 [exp]	1.4	0.9620
AT5G06540			Pentatricopeptide repeat (PPR)...		Lus10029344 [exp]	2.8	0.9225
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10029867 [exp]	5.1	0.8997
AT1G70780			unknown protein		Lus10019143 [exp]	5.5	0.9275
AT5G43390			Uncharacterised conserved prot...		Lus10021875 [exp]	7.9	0.9098
AT1G04980		ATPDI10, ATPDIL...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10015160 [exp]	9.7	0.8917
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10027573 [exp]	9.8	0.8713
AT3G13160			Tetratricopeptide repeat (TPR)...		Lus10007620 [exp]	12.0	0.9003
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10013440 [exp]	12.2	0.9220

Compare expression of checked genes

Lus10020679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.