Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47550 110 / 1e-29 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G02330 107 / 6e-29 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G10720 100 / 1e-27 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) AT3G43270 100 / 4e-26 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G02810 99 / 6e-26 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G26440 99 / 9e-26 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G60730 98 / 2e-25 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G04970 94 / 7e-24 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G05620 91 / 5e-23 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G59010 91 / 7e-23 PME61, PME35 pectin methylesterase 61 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031470 [exp] 148 / 9e-44 AT4G02330 573 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10015210 [exp] 140 / 8e-41 AT4G02330 556 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10028536 [exp] 107 / 2e-30 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10009110 [exp] 107 / 8e-29 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008937 [exp] 100 / 3e-26 AT3G10720 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Lus10028882 [exp] 100 / 5e-26 AT5G04970 704 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10001467 [exp] 87 / 5e-24 AT4G02320 124 / 5e-35 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10029866 [exp] 91 / 6e-23 AT1G02810 511 / 6e-170 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10006103 [exp] 91 / 7e-23 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G022800 [exp] 110 / 5e-30 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.010G247700 [exp] 107 / 8e-29 AT3G10720 746 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Potri.008G011100 [exp] 105 / 6e-28 AT3G10720 744 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2) Potri.014G127000 [exp] 103 / 2e-27 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.002G202600 [exp] 99 / 9e-26 AT1G02810 749 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.018G051200 [exp] 99 / 1e-25 AT2G26450 634 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.006G134500 [exp] 98 / 2e-25 AT4G33220 677 / 0.0 A. THALIANA PECTIN METHYLESTERASE 44, pectin methylesterase 44 (.1) Potri.003G021600 [exp] 98 / 3e-25 AT4G33230 484 / 1e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G127700 [exp] 96 / 1e-24 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.001G209000 [exp] 96 / 1e-24 AT4G33230 483 / 2e-165 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10020680 pacid=23140821 polypeptide=Lus10020680 locus=Lus10020680.g ID=Lus10020680.BGIv1.0 annot-version=v1.0 ATGCAGTCGTACATCGCCAGCTTCCTCGACCCGACCGGTTGGTCTCCGTGGGCCGGGAACGCGTCGCTGGATACGCTTTACTACGCGGAGTTCAACAACT CCGGGATCGGAGCGAGGACCGACGAGAGGGTGAATTGGCCCGGGTTTCACCTGATTAACGAGACTGACGCTGGGAATTTCACGGTGGTGAATTTCACTCA GGGGGATGTTTGGCTGCCGGCGACCGGTGTCCCGTTCGCAACTGGATTGCTTCTACAGTGA
AA sequence Show only first row Show all	>Lus10020680 pacid=23140821 polypeptide=Lus10020680 locus=Lus10020680.g ID=Lus10020680.BGIv1.0 annot-version=v1.0 MQSYIASFLDPTGWSPWAGNASLDTLYYAEFNNSGIGARTDERVNWPGFHLINETDAGNFTVVNFTQGDVWLPATGVPFATGLLLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47550			Plant invertase/pectin methyle...		Lus10020680 [exp]	0	1
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10020679 [exp]	1.4	0.9620
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10027573 [exp]	2.4	0.9045
AT5G43390			Uncharacterised conserved prot...		Lus10021875 [exp]	2.8	0.9202
AT1G31830			Amino acid permease family pro...		Lus10012153 [exp]	3.9	0.9153
AT2G21090			Pentatricopeptide repeat (PPR-...		Lus10005064 [exp]	4.9	0.9138
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10020678 [exp]	5.5	0.9069
AT3G13160			Tetratricopeptide repeat (TPR)...		Lus10007620 [exp]	7.5	0.9038
AT3G59840			unknown protein		Lus10030936 [exp]	8.5	0.8843
AT4G19950			unknown protein		Lus10018322 [exp]	8.5	0.8667
AT4G05400			copper ion binding (.1.2)		Lus10008331 [exp]	11.0	0.8963

Compare expression of checked genes

Lus10020680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.