Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06330 162 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 100 / 4e-27 Heavy metal transport/detoxification superfamily protein (.1) AT1G29100 94 / 4e-25 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 86 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 85 / 2e-21 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 82 / 2e-20 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 77 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 73 / 7e-17 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 71 / 3e-16 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008284 [exp] 91 / 2e-23 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10027470 [exp] 89 / 3e-23 AT3G48970 167 / 2e-54 Heavy metal transport/detoxification superfamily protein (.1) Lus10033250 [exp] 90 / 6e-23 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10019789 [exp] 87 / 2e-22 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 87 / 3e-22 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10016436 [exp] 86 / 1e-21 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10013911 [exp] 86 / 1e-21 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 85 / 1e-21 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10001892 [exp] 84 / 5e-21 AT1G06330 101 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G107500 [exp] 196 / 2e-65 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 192 / 4e-64 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G065600 [exp] 149 / 5e-47 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G056800 [exp] 131 / 5e-40 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 105 / 1e-29 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 97 / 7e-26 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 96 / 2e-25 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 86 / 5e-22 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 85 / 2e-21 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 85 / 2e-21 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10020704 pacid=23140827 polypeptide=Lus10020704 locus=Lus10020704.g ID=Lus10020704.BGIv1.0 annot-version=v1.0 ATGAGAGTACACATCGATTGTGCCGGGTGCGAGAGCAAGGTCAAACATGCCCTTCAAAACCTCAAAGGGGTGGACAATGTGGATATAGAGATGGCTATGC AAAAAGTGACGGTGACGGGATGGGCGGACCAGAAAAAAGTGCTGAAGACAGTGAGGAGGACCGGCCGGAGGGCCGAACTGTGGCAGCCCCTTCCCTACCC TAATATCAACGCCGGCCACCACCACGGCCACGGCCAGTCCGGCCATTACTACAACCAGCATCAGCCGAACGCCCACTCAACGTATTACGCTCCCCAGCCG TCGTCTTCTTACAACTACTACAAGCACGGCTCAGATAACAACGACCATGGCTATTACCGCCATCCCCTCCATTATACCTCTTCGTCCTCGGTTTTCGACC GCCAGACCGGTAGCTTCTTCAGCGACGATAACCCCACCGGCTGTTCCGTCATGTGA
AA sequence Show only first row Show all	>Lus10020704 pacid=23140827 polypeptide=Lus10020704 locus=Lus10020704.g ID=Lus10020704.BGIv1.0 annot-version=v1.0 MRVHIDCAGCESKVKHALQNLKGVDNVDIEMAMQKVTVTGWADQKKVLKTVRRTGRRAELWQPLPYPNINAGHHHGHGQSGHYYNQHQPNAHSTYYAPQP SSSYNYYKHGSDNNDHGYYRHPLHYTSSSSVFDRQTGSFFSDDNPTGCSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06330			Heavy metal transport/detoxifi...		Lus10020704 [exp]	0	1
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Lus10003444 [exp]	1.0	0.9612
AT3G17970		ATTOC64-III	translocon at the outer membra...		Lus10042001 [exp]	4.0	0.9103
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037663 [exp]	4.5	0.9289
AT4G00080		UNE11	unfertilized embryo sac 11, Pl...		Lus10030292 [exp]	6.9	0.9492
AT5G34940		ATGUS3	glucuronidase 3 (.1.2.3)		Lus10038109 [exp]	9.0	0.8999
AT3G07870			F-box and associated interacti...		Lus10012357 [exp]	9.4	0.8689
AT5G45120			Eukaryotic aspartyl protease f...		Lus10018286 [exp]	13.6	0.9250
AT5G60520			Late embryogenesis abundant (L...		Lus10036107 [exp]	14.4	0.9299
AT5G34940		ATGUS3	glucuronidase 3 (.1.2.3)		Lus10008038 [exp]	15.0	0.9004
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10016318 [exp]	16.3	0.8687

Compare expression of checked genes

Lus10020704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.