Lus10020746 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06400 364 / 8e-130 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G16920 346 / 9e-123 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT5G45750 345 / 3e-122 AtRABA1c RAB GTPase homolog A1C (.1)
AT4G18800 340 / 2e-120 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G60860 321 / 9e-113 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 318 / 1e-111 AtRABA1g RAB GTPase homolog A1G (.1)
AT4G18430 313 / 2e-109 AtRABA1e RAB GTPase homolog A1E (.1)
AT1G28550 313 / 2e-109 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 305 / 3e-106 ArRABA1h RAB GTPase homolog A1H (.1)
AT1G09630 296 / 7e-103 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029789 416 / 5e-150 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029253 339 / 8e-120 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 335 / 4e-118 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10017679 326 / 1e-114 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10002178 326 / 1e-114 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10015297 317 / 4e-111 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10025432 314 / 5e-110 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10013961 312 / 3e-109 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10039895 297 / 2e-103 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G070300 357 / 4e-127 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 351 / 1e-124 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.001G374000 333 / 1e-117 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.013G123600 321 / 1e-112 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 320 / 3e-112 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.011G061300 318 / 2e-111 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.003G004100 296 / 1e-102 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.006G000300 291 / 4e-101 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.016G000400 289 / 5e-100 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 283 / 6e-98 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10020746 pacid=23140957 polypeptide=Lus10020746 locus=Lus10020746.g ID=Lus10020746.BGIv1.0 annot-version=v1.0
ATGGCTGGCTACCGACCTGAAGAAGACTACGATTACTTGCTCAAGCTGGTTCTGATCGGCGATTCCGGCGTCGGAAAATCCAACTTGCTCTCCAGGTTCA
CCAAGAACGAGTTCAATCTCGAGTCCAAGTCCACCATCGGGGTCGAGTTCGCCACCAAGAGCATGAACCTCGATGGCAAGGTCATCAAGGCTCAGATTTG
GGACACCGCTGGCCAAGAAAGGTACCGTGCCATAACAAGCGCATACTACAGAGGAGCAGTCGGTGCTTTACTCGTCTACGACGTGACTCGCCGCTCAACA
TTTGAAAACGTGGCGAGGTGGCTGAAAGAGTTGAGGGAGCACACCGACCCCAACATCGTCGTCATGCTCATAGGCAACAAATCAGATCTCAGGCACCTCG
TAGCTGTCCAGACCGAAGATGCGAAAGCATATGCTGAGAGGGAGTCCATGTACTTCATGGAGACATCAGCTCTCACCGCAACAAACGTGGAGAGCGCCTT
CACCGAAGTCATGACGCAGATATACAAGATCGTGAGCAAGCGGACTGTAGATGGAACCAATGACGGCACAACAGGTGTCCCTCTAAAGGGAGAGACCATC
AACGTTAAGCAGGAAGGTTCTGTTCTCAAGAGAATGGGGTGCTGTTCTTAG
AA sequence
>Lus10020746 pacid=23140957 polypeptide=Lus10020746 locus=Lus10020746.g ID=Lus10020746.BGIv1.0 annot-version=v1.0
MAGYRPEEDYDYLLKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSMNLDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRST
FENVARWLKELREHTDPNIVVMLIGNKSDLRHLVAVQTEDAKAYAERESMYFMETSALTATNVESAFTEVMTQIYKIVSKRTVDGTNDGTTGVPLKGETI
NVKQEGSVLKRMGCCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06400 ARA2, AtRABA1a,... ARABIDOPSIS THALIANA RAB GTPAS... Lus10020746 0 1
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Lus10019259 7.5 0.8520
AT3G52560 MMZ4 ,UEV1D ,UE... MMS2 ZWEI HOMOLOGUE 4, ubiquit... Lus10029415 7.7 0.8139
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10028441 13.0 0.8072
AT5G58060 ATYKT61, ATGP1,... SNARE-like superfamily protein... Lus10036297 13.2 0.8107
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10014942 14.6 0.8198
AT1G75540 CO LHUS, AtBBX21, ... long hypocotyl under shade, B-... Lus10033184 14.8 0.8175
AT2G04410 RPM1-interacting protein 4 (RI... Lus10016623 18.8 0.7949
AT2G25280 unknown protein Lus10001925 25.8 0.8022
AT1G11740 ankyrin repeat family protein ... Lus10020036 28.2 0.8189
AT2G28605 Photosystem II reaction center... Lus10038658 30.0 0.7895

Lus10020746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.