Lus10020757 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18260 166 / 9e-49 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT2G30890 153 / 2e-46 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT3G25290 49 / 5e-07 Auxin-responsive family protein (.1.2)
AT4G17280 47 / 2e-06 Auxin-responsive family protein (.1)
AT3G59070 47 / 3e-06 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT4G12980 46 / 5e-06 Auxin-responsive family protein (.1)
AT5G35735 44 / 3e-05 Auxin-responsive family protein (.1)
AT5G47530 43 / 7e-05 Auxin-responsive family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007333 327 / 9e-115 AT4G18260 204 / 2e-62 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10025877 51 / 8e-08 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10038225 50 / 2e-07 AT3G25290 283 / 6e-95 Auxin-responsive family protein (.1.2)
Lus10012625 46 / 8e-06 AT3G61750 400 / 7e-138 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Lus10010120 44 / 4e-05 AT3G61750 343 / 5e-117 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Lus10001162 41 / 0.0002 AT2G04850 563 / 0.0 Auxin-responsive family protein (.1)
Lus10001736 41 / 0.0002 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Lus10006398 40 / 0.0005 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1)
Lus10002274 40 / 0.0007 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G204300 240 / 8e-81 AT2G30890 228 / 7e-75 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.002G057900 227 / 2e-76 AT2G30890 189 / 1e-60 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.011G080400 174 / 2e-54 AT4G18260 254 / 3e-81 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.001G031600 53 / 3e-08 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Potri.019G096400 50 / 3e-07 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1)
Potri.013G118300 49 / 3e-07 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
Potri.019G095800 49 / 3e-07 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.019G096300 49 / 4e-07 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.002G249300 49 / 5e-07 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.019G096600 49 / 8e-07 AT5G47530 296 / 1e-97 Auxin-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10020757 pacid=23140961 polypeptide=Lus10020757 locus=Lus10020757.g ID=Lus10020757.BGIv1.0 annot-version=v1.0
ATGGGGTTCCTGATGCCTGTTGGGATACTAGCTATCAGAATGTCACACAGAGAGGAATGTGGAAGAAGGCTCAAGATTCTGTTCTATGTGGTTGCTGTAC
TTCTTTCTACAGCAGGAGCAATAATGTCATTCAGGAACTTCAGCAACACTTTCAATAATAATCATCAAAGAATTGGTTTATCCCTCTACGGTATAATGTG
GCTGCAAGCTCTAACGGGGTTCTTAAGGCCCTCAAGGGGATCCAAGGGAAGGAGCTTCTGGTTTTGTCTACACTGGATGACTGGGACTACATTGTGTGTA
CTGGGAATCATCAATGTGTATACAGGACTACTAGCATACCACCAGAAGACATCAAGAAGTATAAGTGTATGGATTATAGCACTCACAGTTGAGGTCTGTT
TGCTGGCATTCTTGTACCTGTTCCAGGACAAATGGGGTTACATCAAAAGGCAAGGAGTTATCCTGGGAAATGAACCGGTTAGGCCAATGGAGAAAGTGGT
TGTTTCTCCAGAAGGAGATCCCAAGACCAGATCATTTTCAAAGGCACACGAATCAATCTAG
AA sequence
>Lus10020757 pacid=23140961 polypeptide=Lus10020757 locus=Lus10020757.g ID=Lus10020757.BGIv1.0 annot-version=v1.0
MGFLMPVGILAIRMSHREECGRRLKILFYVVAVLLSTAGAIMSFRNFSNTFNNNHQRIGLSLYGIMWLQALTGFLRPSRGSKGRSFWFCLHWMTGTTLCV
LGIINVYTGLLAYHQKTSRSISVWIIALTVEVCLLAFLYLFQDKWGYIKRQGVILGNEPVRPMEKVVVSPEGDPKTRSFSKAHESI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18260 Cytochrome b561/ferric reducta... Lus10020757 0 1
AT4G18260 Cytochrome b561/ferric reducta... Lus10007333 1.0 0.8855
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10007748 2.0 0.8850
AT5G07800 Flavin-binding monooxygenase f... Lus10003474 2.2 0.8410
AT4G35020 ROP6, ARAC3, RH... RHO-RELATED PROTEIN FROM PLANT... Lus10014123 2.4 0.8493
AT1G04360 RING/U-box superfamily protein... Lus10000710 3.5 0.8222
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10018674 3.5 0.8426
AT1G04360 RING/U-box superfamily protein... Lus10024881 3.7 0.8211
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10040149 6.7 0.7554
AT1G06980 unknown protein Lus10038171 8.5 0.8087
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10043373 9.5 0.7682

Lus10020757 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.