Lus10020764 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42920 225 / 8e-71 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G48910 182 / 6e-54 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G62890 177 / 2e-52 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 177 / 4e-52 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G22410 176 / 2e-51 SLO1 SLOW GROWTH 1 (.1)
AT4G02750 176 / 4e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 174 / 3e-50 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G15930 172 / 4e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G44230 172 / 5e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59200 169 / 8e-50 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007341 393 / 1e-136 AT2G42920 610 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10030053 191 / 7e-57 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033026 189 / 7e-56 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018223 184 / 4e-54 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024199 183 / 2e-53 AT3G09040 1017 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040680 182 / 2e-53 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000110 173 / 2e-53 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015898 181 / 3e-53 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026006 179 / 1e-52 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G202600 275 / 2e-90 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.018G040100 211 / 5e-64 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G239600 191 / 2e-57 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G103600 188 / 2e-56 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G105700 188 / 6e-56 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G031600 188 / 1e-55 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 184 / 1e-54 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G050200 182 / 6e-54 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G071800 182 / 1e-53 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G223900 176 / 3e-52 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10020764 pacid=23140899 polypeptide=Lus10020764 locus=Lus10020764.g ID=Lus10020764.BGIv1.0 annot-version=v1.0
ATGATTCTAGGCCTGGCGACGAACGGTCATGAACAGGAAGCAATCGATCTCATCGGAAAGATTTCGTCCTCGAATTTGGATCCTGATTTCGACAGCTTCA
TCGGCGTCTTGACGGCTTGTAATCACGCGGGCTTGGTCGAAACGGCCAAGGAGTATTTCTCTTTGATGATAGAAACTTACAAGATCAAACCTTTGATACA
GCATTATAGCTGTATGGTCGATGTGCTTGGCCGAGCTGGGTTTCTGGAAGAGGCAGAAGAGCTCATAAAAGGGATGAGCATCAGTCCAGATGCTATCATA
TGGGGATCTTTGTTGTCTTCGAGCGAGATACATGGGAACTTGGAGATGGCAAAACGAGCAGCAAAGCACCTCACTGATTTAGATCCGAGTGGAACATCGA
GCTTCGTTCTTATGTCGGACGCTCATGCTTCATCCGGTCAATTTCAGGAAGCGATCGAGCAGAGGGTCGTTCCGAAAGAAAACCGGATTAAGAAAGTCCC
TGGATGTAATTCGATCGAACTGGACGGAGAAGTCCACGAGTTTGTAGCTGGCGGAAGTTTGCATCCGGAAGCTGGAAAGATCTACGATGCTTCAGATGAA
CTTGGATCGGTATTAAAGCAAACCGAATAG
AA sequence
>Lus10020764 pacid=23140899 polypeptide=Lus10020764 locus=Lus10020764.g ID=Lus10020764.BGIv1.0 annot-version=v1.0
MILGLATNGHEQEAIDLIGKISSSNLDPDFDSFIGVLTACNHAGLVETAKEYFSLMIETYKIKPLIQHYSCMVDVLGRAGFLEEAEELIKGMSISPDAII
WGSLLSSSEIHGNLEMAKRAAKHLTDLDPSGTSSFVLMSDAHASSGQFQEAIEQRVVPKENRIKKVPGCNSIELDGEVHEFVAGGSLHPEAGKIYDASDE
LGSVLKQTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42920 Pentatricopeptide repeat (PPR-... Lus10020764 0 1
Lus10011725 2.6 0.8607
AT5G16030 unknown protein Lus10017573 3.2 0.8486
AT4G35290 ATGLUR2, ATGLR3... GLUTAMATE RECEPTOR 3.2, glutam... Lus10026552 6.5 0.7989
AT2G46500 UBDKGAMMA4, ATP... UBIQUITIN-LIKE DOMAIN KINASE G... Lus10003190 7.7 0.8399
AT2G40770 zinc ion binding;DNA binding;h... Lus10030511 9.4 0.7554
AT1G09940 HEMA2 Glutamyl-tRNA reductase family... Lus10042932 12.0 0.8226
AT5G37020 ARF ARF8, ATARF8 auxin response factor 8 (.1.2) Lus10031354 14.4 0.8439
AT3G47620 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea ... Lus10042195 15.0 0.8165
AT2G42920 Pentatricopeptide repeat (PPR-... Lus10007341 16.6 0.8380
AT5G13100 unknown protein Lus10015761 20.8 0.7947

Lus10020764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.