Lus10020773 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 357 / 2e-124 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 351 / 2e-122 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 343 / 2e-119 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 341 / 3e-118 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 331 / 2e-114 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 330 / 4e-114 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 321 / 2e-110 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 319 / 8e-110 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 311 / 2e-106 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT5G48070 306 / 7e-105 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020772 486 / 1e-175 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 484 / 7e-175 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 423 / 1e-150 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010936 421 / 5e-150 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 421 / 5e-150 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 421 / 7e-150 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007348 427 / 1e-149 AT3G23730 355 / 2e-121 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 417 / 2e-148 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 414 / 3e-147 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G060500 397 / 1e-140 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 396 / 6e-140 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 393 / 7e-139 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 388 / 9e-137 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 381 / 2e-134 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 375 / 6e-132 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 361 / 4e-126 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 352 / 3e-122 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 347 / 1e-120 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 344 / 1e-119 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10020773 pacid=23140898 polypeptide=Lus10020773 locus=Lus10020773.g ID=Lus10020773.BGIv1.0 annot-version=v1.0
ATGGCAGCTGCTGTTCTTCCTTTACTCACATTGGTGCTATTGGGACATCTACTGACCATCTCAGAAGCCAACTTCAACCAACAGTTCGACATCACGTTCG
GAGATCAGCGCGCCCAGATTCAAAACGGTGGCCAACAACTCACTCTCTCGCTGGACAAGTTCTCGGGGTCAGGATTCAAGTCGAAGAGCGAGTACCTCTT
CGGCCGAATCGATATGCAGATCAAGCTCGTCGCTGGCAACTCCGCTGGCACTGTTACCACTTTCTACTTGTCGTCGGAAGGAGCAAACCACGACGAAATC
GACTTCGAATTCCTTGGAAACTCCTCGGGCGATCCGTACCTTATCCATACAAATGTGTTCGCACAGGGGAAAGGAAACAGAGAACAGCAATTCTACCTCT
GGTTTGATCCGACATCTGCATTCCACACCTACTCCATCCTCTGGAATTCCCAACGGATCATATTCTTGGTGGACAACATACCGTTGAGGGTGCACACCAA
CTTGGAATCAAAGGGAGTGCCGTACCCAAGCAAGCAGCCGATGAAGATATACTCGAGCCTGTGGAATGCAGATGACTGGGCGACTCAAGGCGGACGAGTG
AAGACTGACTGGACCAAAGCTCCTTTCGTGGCGTCGTACAGGAACTTCAGTGCTGATGCCTGCGTTTGGTCATCTGGTGCTTCTTCTTGTGGTGCTTCTT
CCGGAAATGGGTTGGAGAATGGAGCTTGGCAGACTCAGGATTTGGATGCGGCCGGAAGGAATAGGCTCCGGTGGGTTCAGAGCAAGTACCTTGTTTATAA
CTATTGTACCGATTTCAAACGATTCCCTCAAGGCTTTCCCATTGAGTGTAATCAAGTAGTGTAA
AA sequence
>Lus10020773 pacid=23140898 polypeptide=Lus10020773 locus=Lus10020773.g ID=Lus10020773.BGIv1.0 annot-version=v1.0
MAAAVLPLLTLVLLGHLLTISEANFNQQFDITFGDQRAQIQNGGQQLTLSLDKFSGSGFKSKSEYLFGRIDMQIKLVAGNSAGTVTTFYLSSEGANHDEI
DFEFLGNSSGDPYLIHTNVFAQGKGNREQQFYLWFDPTSAFHTYSILWNSQRIIFLVDNIPLRVHTNLESKGVPYPSKQPMKIYSSLWNADDWATQGGRV
KTDWTKAPFVASYRNFSADACVWSSGASSCGASSGNGLENGAWQTQDLDAAGRNRLRWVQSKYLVYNYCTDFKRFPQGFPIECNQVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10020773 0 1
AT2G05940 RIPK RPM1-induced protein kinase, P... Lus10034897 3.5 0.8755
AT1G09155 ATPP2-B15 phloem protein 2-B15 (.1) Lus10031473 4.6 0.8850
AT4G15800 RALFL33 ralf-like 33 (.1) Lus10037512 5.0 0.8265
AT2G41410 Calcium-binding EF-hand family... Lus10038970 5.7 0.8673
AT1G76650 CML38 calmodulin-like 38 (.1.2.3) Lus10022343 6.0 0.8797
AT1G20270 2-oxoglutarate (2OG) and Fe(II... Lus10005620 8.7 0.8376
AT5G18150 Methyltransferase-related prot... Lus10019138 9.5 0.8406
AT5G17680 disease resistance protein (TI... Lus10011104 9.6 0.8307
Lus10039778 9.8 0.8491
AT4G35600 Kin4, CX32, CST... kinase 4, CONNEXIN 32, CAST AW... Lus10024512 9.9 0.8439

Lus10020773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.