Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58370 47 / 3e-07 ATXYN1, RXF12 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028243 [exp] 55 / 7e-10 AT1G58370 1278 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10007243 [exp] 52 / 4e-09 AT1G58370 1291 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10011465 [exp] 0 / 1 AT1G10050 807 / 0.0 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10037528 [exp] 0 / 1 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10013322 [exp] 0 / 1 AT1G58370 90 / 8e-23 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G113132 [exp] 47 / 2e-07 AT1G58370 1352 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Potri.002G113066 [exp] 38 / 0.0003 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020790 pacid=23140867 polypeptide=Lus10020790 locus=Lus10020790.g ID=Lus10020790.BGIv1.0 annot-version=v1.0 ATGGATGAGACCTGCACAAATGATCACCGACAAAGTCAAGCTCTTCTTGACAGACTAGATAACTGCTTGGGTCAAGATTGGGCCTACTGGAGCCAATATG GAACTCAAAATGTGAGTGTGGCACTTGGTGTAAACAATAATTGGGTCAATGGAGGACAAGTCGAGATCAACGATGATCGATGGCATGAAATCGGCAGCTC CTTCAGAATCTCTAATTTAAACTTCCTTGTCAAACAGTTTGTGTCGGCTGTTTGGAGCGAGCTTGGTCCACCATCCATGGAATCGAACTGA
AA sequence Show only first row Show all	>Lus10020790 pacid=23140867 polypeptide=Lus10020790 locus=Lus10020790.g ID=Lus10020790.BGIv1.0 annot-version=v1.0 MDETCTNDHRQSQALLDRLDNCLGQDWAYWSQYGTQNVSVALGVNNNWVNGGQVEINDDRWHEIGSSFRISNLNFLVKQFVSAVWSELGPPSMESN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10020790 [exp]	0	1
AT1G51120	AP2_ERF		AP2/B3 transcription factor fa...		Lus10026212 [exp]	1.0	0.8206
AT3G51560			Disease resistance protein (TI...		Lus10014583 [exp]	3.2	0.6494
AT4G18650			transcription factor-related (...		Lus10007282 [exp]	5.9	0.6261
AT3G14880			unknown protein		Lus10013746 [exp]	8.5	0.6993
AT3G18790			unknown protein		Lus10008883 [exp]	21.2	0.6034
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	22.0	0.6801
AT4G05130		ATENT4	equilibrative nucleoside trans...		Lus10002590 [exp]	26.4	0.6247
					Lus10040955 [exp]	28.0	0.6330
AT4G29490			Metallopeptidase M24 family pr...		Lus10037379 [exp]	34.2	0.6650
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	38.5	0.6165

Compare expression of checked genes

Lus10020790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.