Lus10020792 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65820 171 / 1e-55 microsomal glutathione s-transferase, putative (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007373 238 / 6e-82 AT1G65820 207 / 5e-70 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10020793 202 / 2e-67 AT1G65820 218 / 3e-74 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10007375 195 / 1e-64 AT1G65820 222 / 7e-76 microsomal glutathione s-transferase, putative (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140900 189 / 3e-62 AT1G65820 217 / 1e-73 microsomal glutathione s-transferase, putative (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01124 MAPEG MAPEG family
Representative CDS sequence
>Lus10020792 pacid=23140908 polypeptide=Lus10020792 locus=Lus10020792.g ID=Lus10020792.BGIv1.0 annot-version=v1.0
ATGAATCCTAAGAAAGACGCAGAAAGTAAAATCAAGGATGCCCGCCGGCGCCGGAGTTACGGAATTGCTGCCCAAGGAGTACGGCTACGTGGCTCTAGTG
GTAGTAGCCTGTTTCTCACTGAGTTTTACATGGCACGCAAGGTCGTCAGGGCTCGCATGAAATACAACGTCCCTTATCCCACCCTATACGCAATTGAATC
AGAGAACAAACACACTAATCTCTTCAACTGTGTTCAGAGAGGGCATCAGAATTTGCTGGAATTGATTCCGATGTTCTTCATGCTAATCGCATTGGGAGGA
TTGAGGCATCCCTGCGTCGCTGCCGCTCTCGGAGCTTTCTTCGTCGTCACTCGCTACTTCTATTTTACCGGCTACTCCACCGGCGATCCCAAGAATCGCC
TCCCCGTCGGTAAATACGGGCTATTGTCTCTCCTTGGGCTAATGGGTTGCACAATTTCCCTTGGCATCACCCTCCTACGAGCATAG
AA sequence
>Lus10020792 pacid=23140908 polypeptide=Lus10020792 locus=Lus10020792.g ID=Lus10020792.BGIv1.0 annot-version=v1.0
MNPKKDAESKIKDARRRRSYGIAAQGVRLRGSSGSSLFLTEFYMARKVVRARMKYNVPYPTLYAIESENKHTNLFNCVQRGHQNLLELIPMFFMLIALGG
LRHPCVAAALGAFFVVTRYFYFTGYSTGDPKNRLPVGKYGLLSLLGLMGCTISLGITLLRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65820 microsomal glutathione s-trans... Lus10020792 0 1
AT1G07520 GRAS GRAS family transcription fact... Lus10037757 1.4 0.9664
AT3G07990 SCPL27 serine carboxypeptidase-like 2... Lus10036516 1.4 0.9812
AT4G31180 Class II aminoacyl-tRNA and bi... Lus10028557 4.6 0.9475
AT5G51740 Peptidase family M48 family pr... Lus10031682 5.3 0.9461
AT4G20990 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANH... Lus10031027 5.5 0.9451
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10023363 5.7 0.8657
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Lus10031726 5.7 0.9187
AT4G15620 Uncharacterised protein family... Lus10035168 5.8 0.8582
Lus10022950 6.5 0.8340
AT1G75290 NAD(P)-binding Rossmann-fold s... Lus10021709 6.6 0.8965

Lus10020792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.