Lus10020800 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37478 132 / 1e-39 TPX2 (targeting protein for Xklp2) protein family (.1)
AT3G01015 99 / 2e-24 TPX2 (targeting protein for Xklp2) protein family (.1)
AT5G15510 94 / 9e-23 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
AT1G03780 62 / 2e-11 AtTPX2, TPX2 targeting protein for XKLP2 (.1.2.3)
AT2G35880 43 / 5e-05 TPX2 (targeting protein for Xklp2) protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007382 301 / 1e-105 AT5G37478 149 / 1e-45 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10010706 99 / 2e-24 AT5G15510 476 / 2e-165 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Lus10030836 91 / 1e-21 AT3G01015 413 / 8e-141 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10030650 91 / 3e-21 AT5G15510 404 / 4e-137 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Lus10018608 56 / 2e-09 AT1G03780 741 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10017715 54 / 1e-08 AT1G03780 687 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10039844 54 / 2e-08 AT1G03780 689 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10016193 41 / 0.0003 AT2G35880 181 / 7e-52 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10033674 40 / 0.0008 AT1G03780 718 / 0.0 targeting protein for XKLP2 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G144061 162 / 5e-51 AT5G37478 154 / 5e-48 TPX2 (targeting protein for Xklp2) protein family (.1)
Potri.017G092100 96 / 2e-23 AT5G15510 403 / 5e-136 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Potri.004G118700 81 / 5e-18 AT5G15510 410 / 8e-139 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Potri.017G013100 59 / 3e-10 AT1G03780 667 / 0.0 targeting protein for XKLP2 (.1.2.3)
Potri.007G138600 53 / 3e-08 AT1G03780 672 / 0.0 targeting protein for XKLP2 (.1.2.3)
Potri.016G066600 40 / 0.0004 AT2G35880 149 / 5e-40 TPX2 (targeting protein for Xklp2) protein family (.1)
Potri.006G200400 39 / 0.0008 AT2G35880 168 / 1e-46 TPX2 (targeting protein for Xklp2) protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06886 TPX2 Targeting protein for Xklp2 (TPX2) domain
Representative CDS sequence
>Lus10020800 pacid=23140847 polypeptide=Lus10020800 locus=Lus10020800.g ID=Lus10020800.BGIv1.0 annot-version=v1.0
ATGGACAAAGTTCACACTAAGTCCACGAAGACTAGCACCCAATCCTCAGTTACAATGAGCTCTCCTACCAGAGGAATGAGAAAAGAAGAAGGGAAAGAGC
GGGCCGTGGAGAAAACAAAGACAAGCCCAAGAATGAGCCCAGGAGCTTCTTCCAACAAAGAGAACAACACAAACACGAAGAAGCCCAACCAGGAGTTCAA
ACTCCATTCTGAAGAAAGAGCTATGAGACGAGCCATGTTCAACTATTACGTTGCAACCAAAATCTACGTCGTAGAGTACGAAAAAAGACAGCTAGAGAGG
CTCCAAAAGTTGATTGATGAAGAAGAAGTGAAGTCGCTAAGGAAGAAAATGGTTCCCAGAGCTCAATTGATGCCCTACTTTGACAAACCTTTCTCCCCAC
AGAGATCAAACAGGCCACTGACTACGCCAAGAGAGCCAAGAATCAAAGTGGTGAACAATAACAAGTACATGAGTTGCATCTCTGAGAATGAGATGTACAG
TTTTCTGAACCCAGCTAGTCAGCAGCATCAGACATGGAACCCTGCTCATTGA
AA sequence
>Lus10020800 pacid=23140847 polypeptide=Lus10020800 locus=Lus10020800.g ID=Lus10020800.BGIv1.0 annot-version=v1.0
MDKVHTKSTKTSTQSSVTMSSPTRGMRKEEGKERAVEKTKTSPRMSPGASSNKENNTNTKKPNQEFKLHSEERAMRRAMFNYYVATKIYVVEYEKRQLER
LQKLIDEEEVKSLRKKMVPRAQLMPYFDKPFSPQRSNRPLTTPREPRIKVVNNNKYMSCISENEMYSFLNPASQQHQTWNPAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37478 TPX2 (targeting protein for Xk... Lus10020800 0 1
AT2G04850 Auxin-responsive family protei... Lus10001736 1.7 0.9870
AT5G61340 unknown protein Lus10034727 2.8 0.9839
AT5G61340 unknown protein Lus10021641 3.0 0.9831
AT1G11655 unknown protein Lus10020050 4.0 0.9741
AT1G71740 unknown protein Lus10034266 4.2 0.9658
AT2G36880 MAT3 methionine adenosyltransferase... Lus10026541 5.9 0.9772
AT3G61750 Cytochrome b561/ferric reducta... Lus10012625 6.0 0.9819
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Lus10041106 8.1 0.9759
AT2G17940 Plant protein of unknown funct... Lus10041916 10.6 0.9759
AT2G30395 OFP ATOFP17, OFP17 ovate family protein 17 (.1) Lus10009922 10.6 0.9671

Lus10020800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.