Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49410 65 / 3e-16 TOM6 translocase of the outer mitochondrial membrane 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007383 [exp] 91 / 8e-26 AT1G49410 74 / 3e-19 translocase of the outer mitochondrial membrane 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G149200 [exp] 74 / 8e-20 AT1G49410 96 / 1e-28 translocase of the outer mitochondrial membrane 6 (.1) Potri.009G110100 [exp] 72 / 5e-19 AT1G49410 92 / 4e-27 translocase of the outer mitochondrial membrane 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020801 pacid=23140844 polypeptide=Lus10020801 locus=Lus10020801.g ID=Lus10020801.BGIv1.0 annot-version=v1.0 ATGTTTCCGGGGATGTTCATGAAGAAGCCGGACAAGGCGGCGGCGTACAAGGAGCTGAAATACCACGCCGCGATGTTCACTGCCTGGGTCGCCGTCATCC GTATCAGTCCTTACCTTCTCCATTACCTCTCCGCCGCTGAGAAGGAAGAGCTCAAGCTCGAGTTCTAG
AA sequence Show only first row Show all	>Lus10020801 pacid=23140844 polypeptide=Lus10020801 locus=Lus10020801.g ID=Lus10020801.BGIv1.0 annot-version=v1.0 MFPGMFMKKPDKAAAYKELKYHAAMFTAWVAVIRISPYLLHYLSAAEKEELKLEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10020801 [exp]	0	1
AT4G37580		UNS2, COP3, HLS...	UNUSUAL SUGAR RESPONSE 2, HOOK...		Lus10016904 [exp]	9.7	0.9658
AT2G03370			Glycosyltransferase family 61 ...		Lus10036806 [exp]	13.3	0.8784
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10007383 [exp]	15.1	0.9454
AT1G12980	AP2_ERF	DRN, ESR1	ENHANCER OF SHOOT REGENERATION...		Lus10014345 [exp]	15.6	0.9531
AT5G02030	HD	PNY, BLR, BLH9,...	VAAMANA, REPLUMLESS, PENNYWISE...		Lus10004688 [exp]	19.4	0.9507
AT3G47620	TCP	AtTCP14, TCP14	"TEOSINTE BRANCHED, cycloidea ...		Lus10041328 [exp]	20.5	0.8614
					Lus10009719 [exp]	21.1	0.9506
AT1G73620			Pathogenesis-related thaumatin...		Lus10031346 [exp]	25.7	0.9506
AT1G03890			RmlC-like cupins superfamily p...		Lus10003554 [exp]	26.7	0.8784
AT3G53430			Ribosomal protein L11 family p...		Lus10015086 [exp]	27.3	0.8738

Compare expression of checked genes

Lus10020801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.