Plant FIBer expression Database

Lus10020809 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37590 68 / 2e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004034
[exp]
266 / 2e-91 AT5G37590 77 / 2e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G085200
[exp]
120 / 4e-32 AT5G37590 530 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10020809 pacid=23140799 polypeptide=Lus10020809 locus=Lus10020809.g ID=Lus10020809.BGIv1.0 annot-version=v1.0
ATGCAGAATGCCGCCACCATGGCTCAACTGGCGAGGGCAGTGCTGGAAAATTTGGATTCACGAAGCAACGTCAGTCGTTCGGAAGCAGTCCATCAACTAG
AAAAGGCAAACAATCTCTTGAAGAAATCCATTAGGATATCACGAAAAGTCTTGGACAGAATCAGAAAGCCAACTGGAAGTAGACAAAAACATGGATCAAC
TGAAGGAAGTAGACGGGAAGGACGCGTGGCCTTGATAACACTGCTGCAATCACTCGAATTTCTTGGCCTTTTGGAGATCAAACAGCAAGAGTTACAGGAA
AAAGAGAAGAAGTATTCACCTGCTGCCGAGGCTGCACTTTCTCGGTGCATTTCTGTGTACAAAGAGTTCGAAGCTGAGAAATCGATTTCTGACTTCCCTG
AAGTAAAGGCGAAGTACCTGTCTTGCTTGAAGCGCCTGTCTGGTGATAAATCGAAATCAGCAGCCACTTTGGAAGAGCTTAACGATGAAATCAGGCGTGT
TGAAGCTGAAATTTCTCGTCACAAGGGTACCAAACCCTGA
AA sequence
>Lus10020809 pacid=23140799 polypeptide=Lus10020809 locus=Lus10020809.g ID=Lus10020809.BGIv1.0 annot-version=v1.0
MQNAATMAQLARAVLENLDSRSNVSRSEAVHQLEKANNLLKKSIRISRKVLDRIRKPTGSRQKHGSTEGSRREGRVALITLLQSLEFLGLLEIKQQELQE
KEKKYSPAAEAALSRCISVYKEFEAEKSISDFPEVKAKYLSCLKRLSGDKSKSAATLEELNDEIRRVEAEISRHKGTKP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10020809
[exp]
0 1
AT2G17787 unknown protein Lus10013567
[exp]
2.0 0.9152
AT1G35190 2-oxoglutarate (2OG) and Fe(II... Lus10011126
[exp]
4.0 0.9075
AT1G13750 Purple acid phosphatases super... Lus10036902
[exp]
5.0 0.8997
Lus10012945
[exp]
5.5 0.8849
AT2G04865 Aminotransferase-like, plant m... Lus10006393
[exp]
5.8 0.8746
AT3G25060 Tetratricopeptide repeat (TPR)... Lus10025915
[exp]
7.9 0.8482
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10023203
[exp]
10.2 0.8980
AT3G12550 FDM3 factor of DNA methylation 3, X... Lus10000948
[exp]
10.7 0.8996
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Lus10023313
[exp]
12.0 0.8524
AT3G05580 TOPP9 type one protein phosphatase 9... Lus10031489
[exp]
13.6 0.8888

Lus10020809 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.