Lus10020831 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
AT1G50720 86 / 1e-21 Stigma-specific Stig1 family protein (.1)
AT4G26880 70 / 1e-15 Stigma-specific Stig1 family protein (.1)
AT5G55110 66 / 3e-14 Stigma-specific Stig1 family protein (.1)
AT1G53130 66 / 7e-14 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 59 / 3e-11 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012679 300 / 3e-106 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10043047 71 / 1e-15 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10011146 64 / 3e-13 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10011117 64 / 3e-13 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10006512 62 / 9e-13 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10041930 62 / 2e-12 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10000696 62 / 5e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10005544 52 / 3e-09 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G228100 121 / 1e-35 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 120 / 2e-35 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 117 / 2e-34 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 115 / 2e-33 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 116 / 5e-33 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 112 / 2e-32 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 112 / 4e-32 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.011G008804 105 / 2e-29 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 103 / 9e-29 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.011G009000 103 / 1e-28 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10020831 pacid=23178002 polypeptide=Lus10020831 locus=Lus10020831.g ID=Lus10020831.BGIv1.0 annot-version=v1.0
ATGAAGAATTTGATGATGCTCGTTACTCTTGTGACGTCGATGGCCATACTACTCCTGACCGCCAACGTCACACCAACAACATCCCAAGTAGAAGAAAACC
AACCACTCTTCGTCGGCGACGGCACCGGTAGCCGCTTTCTTCTTGATCAGAAAACATCATCTTCTTTGGCGGCGGCAGGGGACAACTGGCGGCGGCGCAA
GTGTGACAAGTTTCCGACGACATGCTACCTGAGAGGGAGCCCGGGCCCGCATTGCTGCAACAGGAAGTGCGTGGACGTCGCTAAGGATCGAACCAACTGC
GGCAAGTGTGGGAGGAGGTGCGGGTACAGCGAGATATGCTGCGGTGGGAAGTGTGTCAACCCGTCGTTCAACCGGTCAAACTGCGGCGGGTGTGGGAACA
AGTGTGATGCTCCTGCGGTCGGTGGTCGCAAAAAGCGGGCTTTCTGTGCGTTCGGCCTCTGCAACTATGCGTAG
AA sequence
>Lus10020831 pacid=23178002 polypeptide=Lus10020831 locus=Lus10020831.g ID=Lus10020831.BGIv1.0 annot-version=v1.0
MKNLMMLVTLVTSMAILLLTANVTPTTSQVEENQPLFVGDGTGSRFLLDQKTSSSLAAAGDNWRRRKCDKFPTTCYLRGSPGPHCCNRKCVDVAKDRTNC
GKCGRRCGYSEICCGGKCVNPSFNRSNCGGCGNKCDAPAVGGRKKRAFCAFGLCNYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11925 Stigma-specific Stig1 family p... Lus10020831 0 1
AT5G14780 FDH formate dehydrogenase (.1) Lus10032150 2.8 0.9874
Lus10043316 2.8 0.9913
AT3G22370 AtHSR3, ATAOX1A... hyper-sensitivity-related 3, a... Lus10035670 3.7 0.9875
AT4G15560 AtCLA1, DXS, DX... 1-DEOXY-D-XYLULOSE 5-PHOSPHATE... Lus10001322 6.8 0.9901
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 8.4 0.9868
AT1G03220 Eukaryotic aspartyl protease f... Lus10010278 8.8 0.9894
Lus10032178 10.2 0.9893
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10024120 10.2 0.9880
AT1G17860 Kunitz family trypsin and prot... Lus10039163 10.4 0.9869
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10030931 10.8 0.9854

Lus10020831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.