Lus10020833 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23260 46 / 2e-06 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2)
AT4G23130 41 / 0.0001 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
AT5G37660 40 / 0.0001 PDLP7 plasmodesmata-located protein 7 (.1.2)
AT4G21230 40 / 0.0002 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
AT4G05200 40 / 0.0002 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT3G22060 39 / 0.0005 Receptor-like protein kinase-related family protein (.1)
AT4G04570 39 / 0.0006 CRK40 cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (.2)
AT4G23320 39 / 0.0007 CRK24 cysteine-rich RLK (RECEPTOR-like protein kinase) 24 (.1)
AT3G21940 39 / 0.0007 Receptor protein kinase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020834 160 / 3e-51 AT1G70520 46 / 3e-06 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1)
Lus10033534 89 / 5e-23 ND /
Lus10012676 59 / 8e-12 ND /
Lus10012677 56 / 2e-10 ND /
Lus10008656 42 / 2e-05 AT4G05200 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10020814 42 / 4e-05 AT5G37660 311 / 2e-106 plasmodesmata-located protein 7 (.1.2)
Lus10018377 42 / 7e-05 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10029122 40 / 0.0003 AT1G70530 789 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10014475 40 / 0.0003 AT1G04520 391 / 1e-137 plasmodesmata-located protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G257300 42 / 6e-05 AT1G04520 243 / 2e-79 plasmodesmata-located protein 2 (.1)
Potri.007G120600 42 / 6e-05 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1)
Potri.011G028700 41 / 0.0001 AT4G21410 460 / 4e-152 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.017G130800 40 / 0.0003 AT5G37660 314 / 1e-107 plasmodesmata-located protein 7 (.1.2)
Potri.004G086000 39 / 0.0003 AT5G37660 301 / 1e-102 plasmodesmata-located protein 7 (.1.2)
Potri.007G120300 39 / 0.0003 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
Potri.007G120601 39 / 0.0004 AT3G22060 199 / 9e-65 Receptor-like protein kinase-related family protein (.1)
Potri.011G030200 39 / 0.0007 AT4G23220 558 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1)
Potri.007G056000 39 / 0.0008 AT4G28670 579 / 0.0 Protein kinase family protein with domain of unknown function (DUF26) (.1)
Potri.011G029900 37 / 0.0008 AT4G05200 112 / 1e-29 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10020833 pacid=23178011 polypeptide=Lus10020833 locus=Lus10020833.g ID=Lus10020833.BGIv1.0 annot-version=v1.0
ATGAAGAACATGGCCCATATCATGACAACTTATTCATTGATCATCTTCCTCGTAGCATTCACATTCAGCAGCATCCTCGTCGTTGAAGGCGGAGGCCCCA
ACATAACCTATGTTCATTCTTCTTGCGGACCGACGAACACAACCAAGGCCAGAATGAGAAAATCAGCACTAAAAGCCATTGATGCTGCTGTCTTTGCTTA
TCCAGGCCCTGGGGAGAAGGCTAGCTGCAGCTCTATGAGGCCTCGCGAAATCGTTGCATCGGCCATGTGTTGGGGAGATATATCTGTTCAGGACTGCAAA
AACTGTCTATGGAATGCGCAGTTCAGGCTGGTTGATTACTACTGCCGAAACCTATTCGGAGGTCAGCTCACACTTACAAACTGCTACTTGAGGTATGAGG
TCTATCCTTTTTGTTCATGA
AA sequence
>Lus10020833 pacid=23178011 polypeptide=Lus10020833 locus=Lus10020833.g ID=Lus10020833.BGIv1.0 annot-version=v1.0
MKNMAHIMTTYSLIIFLVAFTFSSILVVEGGGPNITYVHSSCGPTNTTKARMRKSALKAIDAAVFAYPGPGEKASCSSMRPREIVASAMCWGDISVQDCK
NCLWNAQFRLVDYYCRNLFGGQLTLTNCYLRYEVYPFCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23260 CRK18 cysteine-rich RLK (RECEPTOR-li... Lus10020833 0 1
AT5G26330 Cupredoxin superfamily protein... Lus10006680 6.9 1.0000
AT2G43820 SGT1, ATSAGT1, ... UDP-glucose:salicylic acid glu... Lus10006721 7.2 1.0000
AT2G40070 unknown protein Lus10008717 9.2 1.0000
Lus10010414 11.5 1.0000
Lus10010663 12.5 1.0000
AT2G22620 Rhamnogalacturonate lyase fami... Lus10010628 12.8 1.0000
Lus10014229 14.4 1.0000
AT2G39518 Uncharacterised protein family... Lus10031304 15.3 1.0000
AT4G03230 S-locus lectin protein kinase ... Lus10031602 16.1 1.0000
Lus10035743 17.7 1.0000

Lus10020833 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.