Lus10020840 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39380 37 / 0.0008 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033530 140 / 3e-41 AT4G39380 216 / 2e-64 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G086800 37 / 0.0006 AT4G39380 245 / 2e-76 unknown protein
PFAM info
Representative CDS sequence
>Lus10020840 pacid=23178017 polypeptide=Lus10020840 locus=Lus10020840.g ID=Lus10020840.BGIv1.0 annot-version=v1.0
ATGAGAGGTAGTAAGAAAAAGGCAGCGAAACCAGCTGATGTCCCAGTAATAGTGAAGGATGGAACGAGTTTGTCCCAGAACAGCAAAGCCGCTAAGAGGA
CTAGAAGGCAGTCTCAAAAGCCATCAGGTTTACTTCCGCAAAAAGATGAATCTCCTTTGCCTTCCACATCAGCTAGAGTAACGAATTTGTTACCAGGACT
TGAGGGGAAACCAGGAACTTCTGTACCTCGTGGAAAGATCAAGTTGCAGTTATTCCCCATAGATGAAAACACGTTGAGGGGATTGGAGAAGGTGAAAAGA
AAATAG
AA sequence
>Lus10020840 pacid=23178017 polypeptide=Lus10020840 locus=Lus10020840.g ID=Lus10020840.BGIv1.0 annot-version=v1.0
MRGSKKKAAKPADVPVIVKDGTSLSQNSKAAKRTRRQSQKPSGLLPQKDESPLPSTSARVTNLLPGLEGKPGTSVPRGKIKLQLFPIDENTLRGLEKVKR
K

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020840 0 1
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10017774 4.7 0.8557
AT4G16807 unknown protein Lus10010995 13.1 0.8485
AT2G04865 Aminotransferase-like, plant m... Lus10001737 21.7 0.8507
AT3G51950 C3HZnF Zinc finger (CCCH-type) family... Lus10009964 30.5 0.8437
AT1G08130 ATLIG1 DNA ligase 1 (.1) Lus10021418 31.5 0.8481
AT2G05120 Nucleoporin, Nup133/Nup155-lik... Lus10001742 37.9 0.8478
AT5G67100 ICU2 INCURVATA2, DNA-directed DNA p... Lus10009366 40.5 0.8454
AT3G61740 SDG14, ATX3 SET domain protein 14 (.1.2) Lus10030262 48.4 0.8421
AT1G79890 RAD3-like DNA-binding helicase... Lus10011447 53.6 0.8367
Lus10026146 56.0 0.8390

Lus10020840 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.