Plant FIBer expression Database

Lus10020848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18715 49 / 4e-09 IDL4 inflorescence deficient in abscission (IDA)-like 4 (.1)
AT5G64667 42 / 1e-06 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033523
[exp]
116 / 7e-36 AT3G18715 51 / 8e-10 inflorescence deficient in abscission (IDA)-like 4 (.1)
Lus10005811
[exp]
64 / 7e-15 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G110700
[exp]
63 / 6e-15 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1)
Potri.005G057400
[exp]
61 / 3e-14 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1)
Potri.005G189900
[exp]
40 / 7e-06 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1)
Potri.002G070401
[exp]
38 / 5e-05 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1)
PFAM info
Representative CDS sequence
>Lus10020848 pacid=23177957 polypeptide=Lus10020848 locus=Lus10020848.g ID=Lus10020848.BGIv1.0 annot-version=v1.0
ATGATCATCTTCATCTTGTTGTTGCTAGTGGGGAGAAGCCATGGCTCCAGACCCAGTAGCTCAAAAACTAGTACTAGTACTGTCTTTAGGGTGAAGCCGA
CATCAGAGGATTACTACTACTACAGAGGCCATTTCACTGATTTCCTCCCAAGACATTTGCACCTAATCCCGACTTCTGGGCCTTCCAGGAGACACAATGA
CATTGGATTGCAAGCTTGGGGGTCGCCATGA
AA sequence
>Lus10020848 pacid=23177957 polypeptide=Lus10020848 locus=Lus10020848.g ID=Lus10020848.BGIv1.0 annot-version=v1.0
MIIFILLLLVGRSHGSRPSSSKTSTSTVFRVKPTSEDYYYYRGHFTDFLPRHLHLIPTSGPSRRHNDIGLQAWGSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18715 IDL4 inflorescence deficient in abs... Lus10020848
[exp]
0 1
AT5G45340 CYP707A3 "cytochrome P450, family 707, ... Lus10028594
[exp]
2.0 0.9373
AT5G40020 Pathogenesis-related thaumatin... Lus10008304
[exp]
2.2 0.9491
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10038556
[exp]
4.5 0.9149
AT3G63440 ATCKX6, CKX6, A... CYTOKININ OXIDASE 6, cytokinin... Lus10005317
[exp]
5.0 0.9079
AT4G12440 APT4 adenine phosphoribosyl transfe... Lus10032249
[exp]
6.6 0.8894
AT5G56980 unknown protein Lus10025985
[exp]
7.5 0.9166
AT1G11770 FAD-binding Berberine family p... Lus10023366
[exp]
10.2 0.8961
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Lus10031530
[exp]
12.8 0.8815
AT5G52020 AP2_ERF Integrase-type DNA-binding sup... Lus10031656
[exp]
17.4 0.7959
AT5G48540 receptor-like protein kinase-r... Lus10038227
[exp]
17.5 0.8777

Lus10020848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.