Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40890 156 / 4e-47 REF8, CYP98A3, C3H1 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) AT1G74550 100 / 4e-26 CYP98A9 cytochrome P450, family 98, subfamily A, polypeptide 9 (.1) AT1G74540 89 / 4e-22 CYP98A8 cytochrome P450, family 98, subfamily A, polypeptide 8 (.1) AT1G33720 79 / 9e-19 CYP76C6 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) AT3G26200 79 / 1e-18 CYP71B22 "cytochrome P450, family 71, subfamily B, polypeptide 22", cytochrome P450, family 71, subfamily B, polypeptide 22 (.1) AT3G26300 79 / 1e-18 CYP71B34 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) AT1G33730 77 / 3e-18 CYP76C5 "cytochrome P450, family 76, subfamily C, polypeptide 5", cytochrome P450, family 76, subfamily C, polypeptide 5 (.1) AT2G45560 77 / 6e-18 CYP76C1 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) AT2G45570 77 / 7e-18 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT3G26310 76 / 8e-18 CYP71B35 "cytochrome P450, family 71, subfamily B, polypeptide 35", cytochrome P450, family 71, subfamily B, polypeptide 35 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020847 [exp] 174 / 7e-54 AT2G40890 859 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Lus10033524 [exp] 173 / 2e-53 AT2G40890 866 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Lus10033522 [exp] 168 / 6e-50 AT1G79540 663 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013150 [exp] 96 / 8e-25 AT5G07990 403 / 4e-136 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10008112 [exp] 95 / 2e-24 AT5G07990 407 / 2e-137 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10041951 [exp] 85 / 8e-21 AT3G48280 519 / 0.0 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10017961 [exp] 81 / 2e-19 AT3G48280 502 / 4e-175 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10019457 [exp] 81 / 3e-19 AT3G48280 467 / 2e-161 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10043308 [exp] 80 / 6e-19 AT3G48280 463 / 5e-160 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G033300 [exp] 167 / 4e-51 AT2G40890 897 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Potri.016G031100 [exp] 157 / 2e-47 AT2G40890 796 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Potri.016G031000 [exp] 154 / 2e-46 AT2G40890 776 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Potri.001G167900 [exp] 98 / 2e-25 AT5G07990 369 / 1e-122 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.003G066400 [exp] 94 / 3e-24 AT5G07990 385 / 9e-129 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.001G167800 [exp] 89 / 4e-22 AT5G07990 353 / 2e-116 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G040200 [exp] 86 / 4e-21 AT5G07990 389 / 2e-130 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.003G066600 [exp] 85 / 6e-21 AT5G07990 382 / 1e-127 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.018G051300 [exp] 85 / 1e-20 AT5G07990 379 / 9e-127 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.002G171800 [exp] 84 / 1e-20 AT1G01280 778 / 0.0 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10020849 pacid=23177976 polypeptide=Lus10020849 locus=Lus10020849.g ID=Lus10020849.BGIv1.0 annot-version=v1.0 ATGAAGGGACACTATTATCGGCTGCTCCCATTCGGGGCAGGGAGGCGGGTTTGCCCCGGGGCACAGCTAGCGATCAACTTGGTAACGTCTATGTTGGGAC ACTTGCTGCACCATTTTCAATGGACTCCGCCGGAAGGTGTGAAGCTGGAAGAGATCGACATGTCGGAGAACCCGGGTCTGGTGACTTACATGCGGACGCC ATTGCTGGCCGTGGCTACTCCCCGGCTGCCTTCTCACTTGTACAAACGTGTAGCCGTCAACATGTAA
AA sequence Show only first row Show all	>Lus10020849 pacid=23177976 polypeptide=Lus10020849 locus=Lus10020849.g ID=Lus10020849.BGIv1.0 annot-version=v1.0 MKGHYYRLLPFGAGRRVCPGAQLAINLVTSMLGHLLHHFQWTPPEGVKLEEIDMSENPGLVTYMRTPLLAVATPRLPSHLYKRVAVNM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40890		REF8, CYP98A3, ...	cytochrome P450, family 98, su...		Lus10020849 [exp]	0	1
AT5G13030			unknown protein		Lus10031224 [exp]	3.5	0.7952
AT5G42270		FTSH5, VAR1	VARIEGATED 1, FtsH extracellul...		Lus10016003 [exp]	4.0	0.8277
AT5G60540		EMB2407, ATPDX2...	EMBRYO DEFECTIVE 2407, pyridox...		Lus10041445 [exp]	6.0	0.8246
AT2G40100		LHCB4.3	light harvesting complex photo...		Lus10037836 [exp]	9.5	0.7766
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10037734 [exp]	15.9	0.7680
AT2G40890		REF8, CYP98A3, ...	cytochrome P450, family 98, su...		Lus10020850 [exp]	17.3	0.7634
AT5G50100			Putative thiol-disulphide oxid...		Lus10004232 [exp]	18.3	0.7813
AT2G38905			Low temperature and salt respo...		Lus10023489 [exp]	25.4	0.6380
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016869 [exp]	27.0	0.7575
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10017583 [exp]	29.1	0.7501

Compare expression of checked genes

Lus10020849 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.