Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49170 103 / 1e-29 Protein of unknown function (DUF167) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033521 [exp] 132 / 8e-41 AT1G49170 151 / 3e-48 Protein of unknown function (DUF167) (.1) Lus10042819 [exp] 91 / 1e-24 AT1G49170 54 / 4e-10 Protein of unknown function (DUF167) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G056500 [exp] 117 / 3e-35 AT1G49170 172 / 1e-56 Protein of unknown function (DUF167) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02594 [flax] [poplar] DUF167 Uncharacterised ACR, YggU family COG1872
Representative CDS sequence Show only first row Show all	>Lus10020853 pacid=23177897 polypeptide=Lus10020853 locus=Lus10020853.g ID=Lus10020853.BGIv1.0 annot-version=v1.0 ATGGCTCCTTCGAGCAAGAAAGGTAAAGGAAAGGCGAACTCAGCTCCGTTGCAAAAATCAGAACCAAAACCTTCCTCCGATTTCCCCTCATGTATTCGAT CGGTACCTCCGTCGTCAGTGGCCATCACCATCCACGCGAAGCCCGGCGCTAAATCGGCATCCATCACAGATTTCAGTGACGAAGCTTTAGGAGTGCAGAT CGACGCCCTTGCCAAGGACGGTGAAGCCAACGCAGCTCTTCTTGATTACATCAGCTCTGTAAGCTTAGCTTTCACTAATCTGCTAAATTTCCAATCTTCA CTTTGTGAGAATCGGAGAGAATTTGCTGCATGA
AA sequence Show only first row Show all	>Lus10020853 pacid=23177897 polypeptide=Lus10020853 locus=Lus10020853.g ID=Lus10020853.BGIv1.0 annot-version=v1.0 MAPSSKKGKGKANSAPLQKSEPKPSSDFPSCIRSVPPSSVAITIHAKPGAKSASITDFSDEALGVQIDALAKDGEANAALLDYISSVSLAFTNLLNFQSS LCENRREFAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49170			Protein of unknown function (D...		Lus10020853 [exp]	0	1
					Lus10038805 [exp]	9.2	0.7338
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Lus10039656 [exp]	12.0	0.8117
AT1G32730			unknown protein		Lus10040132 [exp]	17.2	0.7950
AT5G19490	CCAAT		Histone superfamily protein (....		Lus10026780 [exp]	18.6	0.7623
					Lus10042157 [exp]	22.1	0.6977
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10004400 [exp]	23.0	0.7529
					Lus10001297 [exp]	24.4	0.7254
AT3G10490	NAC	ANAC051, ANAC05...	Arabidopsis NAC domain contain...		Lus10038670 [exp]	24.5	0.7559
AT3G10400		U11/U12-31K	U11/U12-31K, RNA recognition m...		Lus10038693 [exp]	28.8	0.7392
AT2G31490			unknown protein		Lus10027603 [exp]	32.4	0.7319

Compare expression of checked genes

Lus10020853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.