Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09830 137 / 5e-44 BolA-like family protein (.1) AT4G26500 49 / 4e-08 SUFE1, EMB1374, CPSUFE, ATSUFE SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) AT1G55805 40 / 3e-05 BolA-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015605 [exp] 51 / 1e-08 AT4G26500 387 / 2e-133 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) Lus10032905 [exp] 49 / 4e-08 AT4G26500 380 / 4e-131 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G309200 [exp] 142 / 6e-46 AT5G09830 132 / 4e-42 BolA-like family protein (.1) Potri.012G036800 [exp] 46 / 8e-08 AT1G55805 130 / 6e-40 BolA-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01722 [flax] [poplar] BolA BolA-like protein
Representative CDS sequence Show only first row Show all	>Lus10020861 pacid=23177925 polypeptide=Lus10020861 locus=Lus10020861.g ID=Lus10020861.BGIv1.0 annot-version=v1.0 ATGGGAGTGACAAAGGAGCAAGTTGAATCGACTTTGAGGTCAAAGCTGAGTCCTTCACATCTGGAAGTGGTGGATACCTCTGGAGGGTGTGGTGCAAGCT TTGAGGTGGAGATTGTGACTGAACAATTTCAGGGGAAACGGTTGCTGGAAAGGCATCGTCTGGTGAATGCAGCTCTGGCAGAGGAGATGAAAGAGATCCA TGCTCTCTCCATAAAGAAAGCTGCGACTCCCGAACAGTGGAAACAGCAGCAAGAGTCTGCAAAACCTAATCCAACAGTTGCTGCCTAA
AA sequence Show only first row Show all	>Lus10020861 pacid=23177925 polypeptide=Lus10020861 locus=Lus10020861.g ID=Lus10020861.BGIv1.0 annot-version=v1.0 MGVTKEQVESTLRSKLSPSHLEVVDTSGGCGASFEVEIVTEQFQGKRLLERHRLVNAALAEEMKEIHALSIKKAATPEQWKQQQESAKPNPTVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	0	1
AT1G76200			unknown protein		Lus10012279 [exp]	1.0	0.9088
AT5G08290		YLS8	YELLOW-LEAF-SPECIFIC GENE 8, m...		Lus10010188 [exp]	1.4	0.8999
AT4G35980			unknown protein		Lus10041889 [exp]	1.7	0.8879
AT3G62450			unknown protein		Lus10021958 [exp]	4.5	0.8788
AT5G59460			scarecrow-like transcription f...		Lus10004969 [exp]	5.3	0.8878
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	5.5	0.8851
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10000601 [exp]	7.1	0.8685
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	7.3	0.8789
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10000920 [exp]	7.4	0.8864
AT5G11900			Translation initiation factor ...		Lus10024986 [exp]	7.5	0.8703

Compare expression of checked genes

Lus10020861 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.