Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30870 95 / 4e-24 Peroxidase superfamily protein (.1) AT2G38390 75 / 8e-17 Peroxidase superfamily protein (.1) AT5G06730 74 / 1e-16 Peroxidase superfamily protein (.1) AT3G03670 74 / 1e-16 Peroxidase superfamily protein (.1) AT2G38380 72 / 6e-16 Peroxidase superfamily protein (.1) AT1G14550 72 / 6e-16 Peroxidase superfamily protein (.1) AT2G18150 71 / 1e-15 Peroxidase superfamily protein (.1) AT3G50990 71 / 2e-15 Peroxidase superfamily protein (.1) AT5G06720 71 / 3e-15 ATPA2 peroxidase 2 (.1) AT2G34060 70 / 4e-15 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038393 [exp] 118 / 4e-33 AT1G30870 350 / 7e-120 Peroxidase superfamily protein (.1) Lus10001228 [exp] 106 / 2e-28 AT1G30870 357 / 8e-123 Peroxidase superfamily protein (.1) Lus10028735 [exp] 77 / 1e-17 AT1G71695 457 / 1e-161 Peroxidase superfamily protein (.1) Lus10038055 [exp] 76 / 3e-17 AT2G41480 243 / 2e-78 Peroxidase superfamily protein (.1) Lus10013955 [exp] 75 / 1e-16 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1) Lus10009990 [exp] 73 / 4e-16 AT2G41480 233 / 2e-74 Peroxidase superfamily protein (.1) Lus10029201 [exp] 71 / 1e-15 AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1) Lus10010716 [exp] 71 / 3e-15 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1) Lus10008168 [exp] 70 / 5e-15 AT5G06720 393 / 5e-137 peroxidase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G175100 [exp] 124 / 2e-35 AT1G30870 299 / 5e-100 Peroxidase superfamily protein (.1) Potri.003G156100 [exp] 105 / 7e-28 AT1G30870 352 / 8e-120 Peroxidase superfamily protein (.1) Potri.001G011500 [exp] 78 / 4e-18 AT5G06720 376 / 6e-131 peroxidase 2 (.1) Potri.004G144600 [exp] 77 / 1e-17 AT1G49570 400 / 8e-140 Peroxidase superfamily protein (.1) Potri.010G236910 [exp] 73 / 3e-16 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 73 / 3e-16 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.013G156500 [exp] 72 / 4e-16 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1) Potri.004G052100 [exp] 72 / 6e-16 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1) Potri.016G132700 [exp] 71 / 1e-15 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1) Potri.007G074700 [exp] 71 / 1e-15 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [flax] [poplar] Peroxidase PF00141 [flax] [poplar] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Lus10020864 pacid=23177894 polypeptide=Lus10020864 locus=Lus10020864.g ID=Lus10020864.BGIv1.0 annot-version=v1.0 ATGGACCGGCTTAGAAAACCCGACCGGAACATGGACGGTGGGTATTTCAGGAATCTGACCCGCGCTTGCAGATTTCCTGGTCGTTTCGTGAACCTGGATG TGACGACGCCGTTTAAGTTCGACGCCCAGTATTATGTGAACTTGGGGAAGAGACTGGGCCTGCTGAAGACGGACCAGCTGCTGTATTCGGACAGGAGAAC GGCGCCGTTCGTGTCGACTTTGGCGAGTCAGCCTGGTTTGTTCGAGGGCCAGTTCGCGGTGTCGATGGTGAAGCTTGGGAACGTGGTGGATGTGAAGCAG AGTGGTGGTGGGGGAGAGATCAGGTGGAACTGCAATTACGTGAACCCTTCCCGTCAACGTCACTGA
AA sequence Show only first row Show all	>Lus10020864 pacid=23177894 polypeptide=Lus10020864 locus=Lus10020864.g ID=Lus10020864.BGIv1.0 annot-version=v1.0 MDRLRKPDRNMDGGYFRNLTRACRFPGRFVNLDVTTPFKFDAQYYVNLGKRLGLLKTDQLLYSDRRTAPFVSTLASQPGLFEGQFAVSMVKLGNVVDVKQ SGGGGEIRWNCNYVNPSRQRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30870			Peroxidase superfamily protein...		Lus10020864 [exp]	0	1
AT1G31690			Copper amine oxidase family pr...		Lus10041208 [exp]	6.9	0.7495
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10030468 [exp]	25.2	0.7592
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10020248 [exp]	30.2	0.7953
AT4G16120		ATSEB1, COBL7	ARABIDOPSIS THALIANA SEC61 BET...		Lus10010023 [exp]	50.9	0.7136
AT1G53210			sodium/calcium exchanger famil...		Lus10033629 [exp]	56.2	0.7597
					Lus10019815 [exp]	56.3	0.7250
AT2G01300			unknown protein		Lus10002277 [exp]	71.9	0.7233
AT2G04220			Plant protein of unknown funct...		Lus10039183 [exp]	82.7	0.7176
AT2G28420		GLYI8	glyoxylase I 8, Lactoylglutath...		Lus10005324 [exp]	88.3	0.7040
AT4G16120		ATSEB1, COBL7	ARABIDOPSIS THALIANA SEC61 BET...		Lus10010022 [exp]	111.8	0.7205

Compare expression of checked genes

Lus10020864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.