Lus10020867 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64700 127 / 5e-36 nodulin MtN21 /EamA-like transporter family protein (.1)
AT1G43650 94 / 3e-23 nodulin MtN21 /EamA-like transporter family protein (.1.2)
AT4G08290 92 / 2e-22 nodulin MtN21 /EamA-like transporter family protein (.1.2)
AT1G21890 83 / 4e-19 nodulin MtN21 /EamA-like transporter family protein (.1)
AT5G07050 81 / 2e-18 nodulin MtN21 /EamA-like transporter family protein (.1)
AT1G68170 78 / 1e-17 nodulin MtN21 /EamA-like transporter family protein (.1)
AT2G40900 74 / 9e-16 nodulin MtN21 /EamA-like transporter family protein (.1)
AT2G39510 72 / 2e-15 nodulin MtN21 /EamA-like transporter family protein (.1)
AT2G37460 69 / 3e-14 nodulin MtN21 /EamA-like transporter family protein (.1)
AT1G44800 66 / 4e-13 nodulin MtN21 /EamA-like transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033510 200 / 3e-64 AT5G64700 322 / 4e-109 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10018890 93 / 2e-23 AT1G43650 237 / 2e-77 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Lus10020987 87 / 2e-20 AT1G25270 301 / 8e-100 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10028586 86 / 6e-20 AT1G43650 314 / 2e-102 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Lus10008706 85 / 9e-20 AT5G07050 543 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10026113 82 / 1e-18 AT5G07050 537 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10041634 81 / 2e-18 AT5G07050 557 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10028030 81 / 3e-18 AT4G08300 455 / 8e-161 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10008708 81 / 4e-18 AT5G07050 552 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G004100 144 / 4e-42 AT5G64700 339 / 3e-115 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.001G307800 119 / 1e-32 AT5G64700 293 / 2e-97 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.005G192100 109 / 4e-29 AT1G43650 305 / 2e-102 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Potri.002G068300 107 / 2e-28 AT1G43650 360 / 6e-124 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Potri.011G148600 100 / 1e-25 AT5G64700 219 / 1e-68 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.006G033500 84 / 2e-19 AT5G07050 474 / 5e-167 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.016G031400 83 / 3e-19 AT5G07050 504 / 4e-179 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.011G148400 82 / 6e-19 AT5G07050 261 / 3e-84 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.001G032500 82 / 1e-18 AT5G07050 530 / 0.0 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.005G176200 81 / 2e-18 AT4G08300 465 / 2e-164 nodulin MtN21 /EamA-like transporter family protein (.1)
PFAM info
Representative CDS sequence
>Lus10020867 pacid=23177929 polypeptide=Lus10020867 locus=Lus10020867.g ID=Lus10020867.BGIv1.0 annot-version=v1.0
ATGTTCACAGCGCTACAATGCTTTCTAAGCGCAATTCAGTCCTTTGTGGTTGCTATTGCTGTTGAGAGGAATCCTGACGAGTGGAAGCTAGGCTGGAACA
CCCGGCTCGTCGCAGTGGCTTACTGTGGAATAGTTGTGACAGGAGTAACGTATTACTTGCATGCTTGGGTGCTGGAAAAGAAAGGGCCAGTCTTCTTGGC
ATGTCCACTCCTCTGGCTCTCATCTTCACTATGGTTTGTTCCGCACTTCTCTGCGACTTCATCACCCTCGGAAGGTAAAACCGACTCGATTCATTTCAAT
TTCTGCCCTATTCAGTCCGATTCTATTCTGGGTGGAGTGATGTTGGTTGGAGGGCTTTACAGTGTGCTGTGGGCAAAAGGCAGAGAAGAGAAGATGATCC
ATGATGATGATGATGGTGAGATCCAGAAGATCCCCAACATGGCTGGAGAATCAGAGCTCAAAGAAATTGTCACAACTGATTAA
AA sequence
>Lus10020867 pacid=23177929 polypeptide=Lus10020867 locus=Lus10020867.g ID=Lus10020867.BGIv1.0 annot-version=v1.0
MFTALQCFLSAIQSFVVAIAVERNPDEWKLGWNTRLVAVAYCGIVVTGVTYYLHAWVLEKKGPVFLACPLLWLSSSLWFVPHFSATSSPSEGKTDSIHFN
FCPIQSDSILGGVMLVGGLYSVLWAKGREEKMIHDDDDGEIQKIPNMAGESELKEIVTTD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64700 nodulin MtN21 /EamA-like trans... Lus10020867 0 1
Lus10026869 1.0 0.8759
Lus10031737 3.0 0.8142
Lus10008920 4.0 0.8698
AT3G01490 Protein kinase superfamily pro... Lus10030868 4.8 0.7011
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10010501 5.5 0.7921
Lus10010697 8.2 0.7980
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Lus10021184 8.5 0.7612
AT4G13230 Late embryogenesis abundant pr... Lus10022822 9.2 0.7980
AT5G20610 unknown protein Lus10025003 10.1 0.7980
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10042522 10.6 0.7691

Lus10020867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.