Lus10020938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39650 54 / 2e-09 Protein of unknown function (DUF506) (.1)
AT3G22970 41 / 8e-05 Protein of unknown function (DUF506) (.1), Protein of unknown function (DUF506) (.2)
AT4G14620 39 / 0.0006 Protein of unknown function (DUF506) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000956 63 / 1e-12 AT2G39650 266 / 1e-89 Protein of unknown function (DUF506) (.1)
Lus10002695 63 / 2e-12 AT2G39650 313 / 4e-107 Protein of unknown function (DUF506) (.1)
Lus10023412 54 / 3e-09 AT2G39650 273 / 2e-91 Protein of unknown function (DUF506) (.1)
Lus10040293 50 / 6e-08 AT2G39650 270 / 5e-90 Protein of unknown function (DUF506) (.1)
Lus10003087 38 / 0.001 AT3G22970 318 / 7e-107 Protein of unknown function (DUF506) (.1), Protein of unknown function (DUF506) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G056100 58 / 9e-11 AT2G39650 293 / 3e-99 Protein of unknown function (DUF506) (.1)
Potri.010G203700 57 / 2e-10 AT2G39650 287 / 9e-97 Protein of unknown function (DUF506) (.1)
Potri.005G216900 42 / 4e-05 AT3G22970 320 / 2e-107 Protein of unknown function (DUF506) (.1), Protein of unknown function (DUF506) (.2)
Potri.002G046300 40 / 0.0001 AT3G22970 322 / 5e-108 Protein of unknown function (DUF506) (.1), Protein of unknown function (DUF506) (.2)
Potri.008G159800 39 / 0.0006 AT3G22970 350 / 3e-119 Protein of unknown function (DUF506) (.1), Protein of unknown function (DUF506) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04720 PDDEXK_6 PDDEXK-like family of unknown function
Representative CDS sequence
>Lus10020938 pacid=23178015 polypeptide=Lus10020938 locus=Lus10020938.g ID=Lus10020938.BGIv1.0 annot-version=v1.0
ATGAATCCGGTTGTTTATGTGGGATTTTTGGATGGGCTTAAGCACCATCTCCAAGTCATTATTGAAGCTGCTAAGTCTTCGCTTAAACAAAACTCGATGC
CTCTTCCTCCTTGGATTAACGCCTCCACCGATTTCCGCTCCCAAATCGACTACGTCGGCGGCTTGATACTCACCGGTCGACACGCCTTCCTTCCCCGCTC
TCGAAATCCGCCGCTATGTCTCCGGCCGCTGCCACGACGTCCTCAACTTGGGTGCCGCAATCGACGCATCCCATTTCACGTGGAAAGGGGAATCGACGAT
TGGATACCGCGAACTGATGGAGATGCGAAAACGTTGGAACCGGAAGCTCCGCTTGGGATATGTTTCCCTTGTTGGATTCGATCTAGATTTGGTTTATAG
AA sequence
>Lus10020938 pacid=23178015 polypeptide=Lus10020938 locus=Lus10020938.g ID=Lus10020938.BGIv1.0 annot-version=v1.0
MNPVVYVGFLDGLKHHLQVIIEAAKSSLKQNSMPLPPWINASTDFRSQIDYVGGLILTGRHAFLPRSRNPPLCLRPLPRRPQLGCRNRRIPFHVERGIDD
WIPRTDGDAKTLEPEAPLGICFPCWIRSRFGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G39650 Protein of unknown function (D... Lus10020938 0 1
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Lus10024300 4.5 0.8681
AT1G01580 FRD1, ATFRO2, F... FERRIC CHELATE REDUCTASE DEFEC... Lus10039268 4.5 0.8690
AT5G23240 DNAJ heat shock N-terminal dom... Lus10022246 6.7 0.8603
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Lus10000705 6.9 0.8620
AT5G36930 Disease resistance protein (TI... Lus10007809 11.0 0.8614
AT1G19670 CORI1, ATHCOR1,... CORONATINE-INDUCED PROTEIN 1, ... Lus10004076 14.5 0.8280
AT5G40100 Disease resistance protein (TI... Lus10000329 18.0 0.8547
AT4G16970 Protein kinase superfamily pro... Lus10040153 19.7 0.8386
AT2G25625 unknown protein Lus10008096 20.4 0.8141
AT5G61340 unknown protein Lus10003483 22.8 0.8081

Lus10020938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.