Lus10020958 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040788 40 / 0.0001 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10020958 pacid=23148977 polypeptide=Lus10020958 locus=Lus10020958.g ID=Lus10020958.BGIv1.0 annot-version=v1.0
ATGACTTGCAGTCATTCACGGCAACAACAACCACGAGGGGATAGATCGATCGAAGACAAGATGCAAGATTCGACTGCTCGAGACAAGATGCAACAACCCA
AATCAAGAGCAGAACTCTACATCAACCAACCGATCAACGTGGATAGGAACAACTCCTGTGATTCCAAAGGTTGCCGTCTAACTCTATTCTCAAACCAATC
TACAAGCGAGCACCCAATCTTCCTCAAGCTCCATCACCGTTGTTGCCCGTTTCCGTTATTGTCGCTACCCGTCTCCGCCGAAAACCACCGTTTATTCATT
AATCGCCACCGTCGTCTTTTTAATCCACAAATGAATGACCGTCGATTTCGAAAACAACCATCGACGACAACAACAACTTTAGGATACGACCTATATCGGT
GA
AA sequence
>Lus10020958 pacid=23148977 polypeptide=Lus10020958 locus=Lus10020958.g ID=Lus10020958.BGIv1.0 annot-version=v1.0
MTCSHSRQQQPRGDRSIEDKMQDSTARDKMQQPKSRAELYINQPINVDRNNSCDSKGCRLTLFSNQSTSEHPIFLKLHHRCCPFPLLSLPVSAENHRLFI
NRHRRLFNPQMNDRRFRKQPSTTTTTLGYDLYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020958 0 1
Lus10003774 2.8 1.0000
Lus10003695 3.0 1.0000
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10005596 3.5 1.0000
AT4G35260 IDH-I, IDH1 isocitrate dehydrogenase I, is... Lus10014436 4.0 1.0000
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Lus10015428 4.5 1.0000
Lus10033071 4.9 1.0000
AT5G53820 Late embryogenesis abundant pr... Lus10007566 5.3 1.0000
AT1G45063 copper ion binding;electron ca... Lus10020276 6.2 0.6922
Lus10029489 6.9 0.9558
AT5G61890 AP2_ERF Integrase-type DNA-binding sup... Lus10022426 7.3 0.8686

Lus10020958 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.