Lus10020969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33910 91 / 2e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G23096 73 / 1e-15 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G28480 43 / 4e-05 Oxoglutarate/iron-dependent oxygenase (.1.2)
AT1G20270 39 / 0.001 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011084 63 / 2e-13 AT4G33910 120 / 4e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011085 50 / 2e-07 AT4G33910 241 / 4e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10032184 42 / 6e-05 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G091000 94 / 3e-23 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G296800 88 / 4e-21 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.007G052600 74 / 5e-16 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10020969 pacid=23148951 polypeptide=Lus10020969 locus=Lus10020969.g ID=Lus10020969.BGIv1.0 annot-version=v1.0
ATGCCATCATTCAGATCACAAAGCCCAAACTTGGACCCTCTCTCCTTGCCTTGCGTGAGGGAGAAAGTGCCGAGAGTACTAAGGGCACTAGAACCAGGCA
CCTTTATCTCTGCATCGGAAGATGAAACTGGAACCTTGGCTTCGATTGAACAAAAAATTGCAAGAGCTACCATGATCCCGACTACCCATGGTGAGAATGG
CACAAAAATCCCCGGATATGATTACAAACAATGTGTTGGTTTAAAAGTGAAGCCTCGGCAAGGCGACGGCCTTTTATTTTACAATGTTTTTCCTAATGGC
ACAATTGATAAGGCAGTCATGGGAGGCAACTACCATGGAGGTTACTTCCCACGTCTTGATATAATTTCCCTTCCTCAACTGTCTTGGATTGTAGTGTTGG
CGGTTTCTTCTCTTCAACGACTTTGGTGTTCTCTTATTGGTGAGATACTTTGGAGTGTGAATATGATTGAGGTCGTCGACAAGATGACAATACTAGATGG
TACTGATGAGATAACAGGGATGGCATGGAGGCATACATCGTAA
AA sequence
>Lus10020969 pacid=23148951 polypeptide=Lus10020969 locus=Lus10020969.g ID=Lus10020969.BGIv1.0 annot-version=v1.0
MPSFRSQSPNLDPLSLPCVREKVPRVLRALEPGTFISASEDETGTLASIEQKIARATMIPTTHGENGTKIPGYDYKQCVGLKVKPRQGDGLLFYNVFPNG
TIDKAVMGGNYHGGYFPRLDIISLPQLSWIVVLAVSSLQRLWCSLIGEILWSVNMIEVVDKMTILDGTDEITGMAWRHTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33910 2-oxoglutarate (2OG) and Fe(II... Lus10020969 0 1
Lus10001326 6.9 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 8.7 1.0000
Lus10026755 12.0 1.0000
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10008511 13.9 1.0000
AT1G04410 c-NAD-MDH1 cytosolic-NAD-dependent malate... Lus10021183 14.7 1.0000
AT2G43610 Chitinase family protein (.1) Lus10020253 15.5 1.0000
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10028908 17.9 1.0000
Lus10040552 17.9 1.0000
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10023221 20.4 1.0000
Lus10002413 21.4 1.0000

Lus10020969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.