Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06470 99 / 1e-26 GNS1/SUR4 membrane protein family (.1) AT3G06460 77 / 2e-18 GNS1/SUR4 membrane protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012685 [exp] 130 / 1e-37 AT3G06470 259 / 3e-84 GNS1/SUR4 membrane protein family (.1) Lus10020825 [exp] 129 / 1e-37 AT3G06460 260 / 5e-85 GNS1/SUR4 membrane protein family (.1) Lus10012894 [exp] 77 / 2e-18 AT3G06470 298 / 5e-102 GNS1/SUR4 membrane protein family (.1) Lus10030547 [exp] 74 / 2e-17 AT3G06470 330 / 1e-114 GNS1/SUR4 membrane protein family (.1) Lus10016797 [exp] 45 / 1e-06 AT4G36830 296 / 2e-101 GNS1/SUR4 membrane protein family (.1) Lus10022493 [exp] 40 / 5e-05 AT4G36830 374 / 7e-131 GNS1/SUR4 membrane protein family (.1) Lus10018795 [exp] 37 / 0.0004 AT4G36830 157 / 1e-48 GNS1/SUR4 membrane protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G019800 [exp] 129 / 1e-38 AT3G06470 280 / 2e-94 GNS1/SUR4 membrane protein family (.1) Potri.003G019700 [exp] 107 / 3e-30 AT3G06470 315 / 2e-108 GNS1/SUR4 membrane protein family (.1) Potri.007G031500 [exp] 42 / 6e-06 AT4G36830 368 / 6e-129 GNS1/SUR4 membrane protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01151 [flax] [poplar] ELO GNS1/SUR4 family
Representative CDS sequence Show only first row Show all	>Lus10020972 pacid=23148960 polypeptide=Lus10020972 locus=Lus10020972.g ID=Lus10020972.BGIv1.0 annot-version=v1.0 ATGTGCTCTCTTGTCAAGAGACCAAAGTGGAAGAAGCTGGTCACCGACTGTCAGATTCTTCAGTTTTATTCTAGCTTTGGGATCATGTGTTGGATCTTTT ACTACCATTTCACTGGCTCGGGTTGCTCAGGGATATGGGGTTGGTGTTTTGACGCTGTCTTTATTGCGTCGCTTCTCTTCTTGTTCTTGGATTTCCATGC AAAGAATTATAAGCATGGTGGGTGGGGGGGACGACAAGAGGAGGAACAATAA
AA sequence Show only first row Show all	>Lus10020972 pacid=23148960 polypeptide=Lus10020972 locus=Lus10020972.g ID=Lus10020972.BGIv1.0 annot-version=v1.0 MCSLVKRPKWKKLVTDCQILQFYSSFGIMCWIFYYHFTGSGCSGIWGWCFDAVFIASLLFLFLDFHAKNYKHGGWGGRQEEEQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06470			GNS1/SUR4 membrane protein fam...		Lus10020972 [exp]	0	1

Compare expression of checked genes

Lus10020972 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.