Lus10020975 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G42860 42 / 5e-05 zinc knuckle (CCHC-type) family protein (.1)
AT5G13920 42 / 0.0001 GRF zinc finger / Zinc knuckle protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025368 285 / 4e-100 AT3G42860 44 / 1e-05 zinc knuckle (CCHC-type) family protein (.1)
Lus10013881 135 / 8e-41 ND 37 / 0.003
Lus10032472 43 / 8e-06 ND 35 / 0.004
Lus10004093 42 / 3e-05 ND 39 / 6e-04
Lus10011629 41 / 8e-05 ND 39 / 6e-04
Lus10014888 40 / 0.0002 ND 39 / 7e-04
Lus10026593 0 / 1 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G094001 120 / 8e-35 AT3G42860 44 / 3e-05 zinc knuckle (CCHC-type) family protein (.1)
Potri.001G318100 43 / 3e-05 AT3G42860 211 / 8e-66 zinc knuckle (CCHC-type) family protein (.1)
Potri.009G112676 40 / 0.0003 AT5G13920 116 / 7e-28 GRF zinc finger / Zinc knuckle protein (.1)
Potri.T125604 40 / 0.0003 AT5G13920 115 / 1e-27 GRF zinc finger / Zinc knuckle protein (.1)
Potri.T125504 40 / 0.0004 AT5G13920 106 / 1e-25 GRF zinc finger / Zinc knuckle protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF06839 zf-GRF GRF zinc finger
Representative CDS sequence
>Lus10020975 pacid=23148982 polypeptide=Lus10020975 locus=Lus10020975.g ID=Lus10020975.BGIv1.0 annot-version=v1.0
ATGAGCGACTGTGATGGATCTGATGCAAGTTCATGTCATGGTTCTGATTTGGGCTACGATGATTCGGCGCCACAATGCGCTTGTGGATTGCCTTCCAAAC
TACGTATCTCTCAAACCGCCAGGAACCCGTTTCGCTTATTTTACAACTGCCCAAGGAGATACGAGCAATGTGACTTCTTCCGTTGGTGTGATGATCCATC
CCTAACTGGTGATAGGCATGCTGAAGAGCTAAACCTGATTCGCAATACATGCACCCGACTTCAACGTAGATTGAGTAAAGCCCAACGCGACCATGAGAGT
GAAAGAGACAAGTGGGAAATTGAAAAAGAGGAGCTTATCTCTAAACTGTACAAATTTCAACTAGAGTTAGATGAATACAAACAGATGATTAAGCTTGCTG
CAGAGTCTGATCTTATGCCACCAATTGATGATCAAATCTGGAAATGTGAAGACGACGATGATGCTGCTATTGAGATACATGCTATCTCTAATTAA
AA sequence
>Lus10020975 pacid=23148982 polypeptide=Lus10020975 locus=Lus10020975.g ID=Lus10020975.BGIv1.0 annot-version=v1.0
MSDCDGSDASSCHGSDLGYDDSAPQCACGLPSKLRISQTARNPFRLFYNCPRRYEQCDFFRWCDDPSLTGDRHAEELNLIRNTCTRLQRRLSKAQRDHES
ERDKWEIEKEELISKLYKFQLELDEYKQMIKLAAESDLMPPIDDQIWKCEDDDDAAIEIHAISN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13920 GRF zinc finger / Zinc knuckle... Lus10020975 0 1
AT2G40170 GEA6, ATEM6 LATE EMBRYOGENESIS ABUNDANT 6,... Lus10030394 2.8 0.7351
AT5G62840 Phosphoglycerate mutase family... Lus10030165 6.3 0.6776
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10034969 13.3 0.6330
AT3G03470 CYP89A9 "cytochrome P450, family 87, s... Lus10020361 16.2 0.6051
Lus10024622 17.0 0.6271
AT1G14200 RING/U-box superfamily protein... Lus10042171 19.2 0.5861
AT2G39350 ABCG1 ATP-binding cassette G1, ABC-2... Lus10025149 22.9 0.5994
AT2G06090 Plant self-incompatibility pro... Lus10029389 24.5 0.5994
AT5G16100 unknown protein Lus10004035 30.0 0.5453
Lus10021867 30.0 0.6103

Lus10020975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.