Lus10020982 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26070 265 / 2e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26080 245 / 7e-82 plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT5G19940 63 / 9e-12 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT5G09820 62 / 5e-11 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT4G22240 58 / 1e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 57 / 3e-09 FIB fibrillin (.1)
AT1G51110 52 / 9e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT2G35490 48 / 3e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G23400 47 / 5e-06 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033514 68 / 2e-13 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10020860 67 / 3e-13 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10010444 66 / 5e-12 AT1G51110 490 / 2e-173 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10012100 64 / 1e-11 AT1G51110 511 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10026221 59 / 5e-10 AT5G19940 276 / 4e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10021209 57 / 2e-09 AT3G23400 305 / 4e-104 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10011803 57 / 2e-09 AT3G23400 307 / 5e-105 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10001099 56 / 6e-09 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10035384 56 / 6e-09 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G209600 318 / 2e-110 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G020700 280 / 1e-94 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G309300 72 / 2e-14 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Potri.008G169100 58 / 1e-09 AT3G23400 267 / 2e-89 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.004G003200 57 / 3e-09 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.006G276400 56 / 5e-09 AT5G19940 279 / 2e-95 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Potri.001G137900 56 / 7e-09 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G011700 56 / 7e-09 AT1G51110 532 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G095900 54 / 4e-08 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10020982 pacid=23148950 polypeptide=Lus10020982 locus=Lus10020982.g ID=Lus10020982.BGIv1.0 annot-version=v1.0
ATGGCCTTATCTTCTCCTACCACCACTACTTTTGCCACCACCGCCATCTTTTCCGGCCACCCACCACTTCATCAGACACTTTTTCTGCATTCCTCCCACT
CTCCGGCCACTGTCCCCATCTTTTCCCTCTCCCGAAGACTGCCCTTCGCCTCCACCACCCTCCATACCAGAAATAGTAACAATAACTGGAGAACCAATGT
TTCTTTCCTTCCCGCGTTCTTCAAATCTCCACGGAAAGACGTTAACGCTCTAAAGGCGGAGCTTCTTCAAGCTATCGCCCTTCTCGATCGCGGCGCGGAC
GCTACTCCTGATGTCCAGAAAATTGTCGATCAGATTGCTCGAAAGCTGGAATCAGCCAATCCCACTAAGGAGCCATTGAAATCAGATCTGCTGAATGGGA
AATGGGAACTTATATACACTACTTCCGTGTCAATTCTCCAGACTCAGAGGCCAAAGTTGCTGAGGTCGAGAACCAACTACCAAGCTATCAATGCGGATAC
ATTGCGTGCCCAGAACATGGAATCTTGGCCATTCTTTAACCAAGTAACAGCAGACTTGACCCCTCTCAACGCAAGAAAAGTGGCTGTCAAGTTTGATTAC
TTCAAAATCTTTGGTTTGATTCCGGTTAAGGCACCAGAAAGAGCTCGCGGGGAGCTGGAAATCACCTACTTAGATGAAGAGTTGAGAATATCCAGAGGTG
ACAAAGGAAACTTGTTTATCCTGAAAATGCTGGATCCTTCTTACCGTGTCCCTGTCTGA
AA sequence
>Lus10020982 pacid=23148950 polypeptide=Lus10020982 locus=Lus10020982.g ID=Lus10020982.BGIv1.0 annot-version=v1.0
MALSSPTTTTFATTAIFSGHPPLHQTLFLHSSHSPATVPIFSLSRRLPFASTTLHTRNSNNNWRTNVSFLPAFFKSPRKDVNALKAELLQAIALLDRGAD
ATPDVQKIVDQIARKLESANPTKEPLKSDLLNGKWELIYTTSVSILQTQRPKLLRSRTNYQAINADTLRAQNMESWPFFNQVTADLTPLNARKVAVKFDY
FKIFGLIPVKAPERARGELEITYLDEELRISRGDKGNLFILKMLDPSYRVPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26070 Plastid-lipid associated prote... Lus10020982 0 1
AT4G14450 ATBET12 unknown protein Lus10021878 1.0 0.9455
AT3G02730 TRXF1, ATF1 thioredoxin F-type 1 (.1) Lus10020199 2.4 0.9326
AT4G26860 Predicted pyridoxal phosphate-... Lus10032558 4.7 0.9113
AT2G36895 unknown protein Lus10023001 6.0 0.9218
AT1G34000 OHP2 one-helix protein 2 (.1) Lus10000462 7.9 0.9138
AT4G14615 unknown protein Lus10006639 7.9 0.9295
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Lus10041209 8.1 0.9249
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Lus10021923 8.7 0.9258
AT1G34000 OHP2 one-helix protein 2 (.1) Lus10017779 8.8 0.8796
AT4G28030 Acyl-CoA N-acyltransferases (N... Lus10019975 11.0 0.8786

Lus10020982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.