Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G088200 [exp] 91 / 7e-24 ND / Potri.001G293700 [exp] 90 / 2e-23 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020988 pacid=23148983 polypeptide=Lus10020988 locus=Lus10020988.g ID=Lus10020988.BGIv1.0 annot-version=v1.0 ATGGAGAGGTCAATCTTTGGGATTGGGTTGTTCATCGGAGCTGTTGCCATCAGACATGGTTACGATTGTGGATGCAACGGTGCTCAGTTGCTTGCCGTTA ATGACTCTGACCTTTACCACCCAAGGTTCTACAACAGAATTGGGTTCAAACAAGTTCAGCAAGTGCTGGCTCAACGATTGGAGATGTTCCTCACATGTTG GTTTGGGGAGGAATCGGAACAAGAATGGATGCTCAAATTCATCACCTTCTCAAATGGTGCACAAGGTTCACACCTTCCACCTAACTACTAA
AA sequence Show only first row Show all	>Lus10020988 pacid=23148983 polypeptide=Lus10020988 locus=Lus10020988.g ID=Lus10020988.BGIv1.0 annot-version=v1.0 MERSIFGIGLFIGAVAIRHGYDCGCNGAQLLAVNDSDLYHPRFYNRIGFKQVQQVLAQRLEMFLTCWFGEESEQEWMLKFITFSNGAQGSHLPPNY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020988 [exp]	0	1
					Lus10039973 [exp]	3.9	0.8160
					Lus10024734 [exp]	6.2	0.7846
AT2G26480		UGT76D1	UDP-glucosyl transferase 76D1 ...		Lus10017203 [exp]	7.9	0.7213
AT5G16910		ATCSLD2	cellulose-synthase like D2 (.1...		Lus10012119 [exp]	10.2	0.6115
AT1G23030		PUB11	ARM repeat superfamily protein...		Lus10014900 [exp]	13.0	0.6720
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10038796 [exp]	14.7	0.5824
					Lus10003695 [exp]	17.9	0.6350
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040724 [exp]	19.2	0.6350
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	20.3	0.6350
					Lus10020958 [exp]	21.4	0.6350

Compare expression of checked genes

Lus10020988 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.