Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26520 49 / 3e-08 unknown protein AT3G57500 40 / 4e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023859 [exp] 66 / 5e-15 AT2G26520 66 / 5e-15 unknown protein Lus10021765 [exp] 51 / 2e-09 AT2G26520 79 / 7e-20 unknown protein Lus10032762 [exp] 51 / 3e-09 AT2G26520 81 / 3e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G035400 [exp] 55 / 9e-11 AT2G26520 86 / 3e-22 unknown protein Potri.009G106300 [exp] 50 / 4e-09 AT2G26520 77 / 4e-19 unknown protein Potri.004G144400 [exp] 50 / 9e-09 AT2G26520 81 / 3e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020993 pacid=23182411 polypeptide=Lus10020993 locus=Lus10020993.g ID=Lus10020993.BGIv1.0 annot-version=v1.0 ATGGCGTCGGTGGGAGCTGCGATAGCGGCGGTGGCGGTCATAACGGTGTTGGGAGTAATCGCTTGCGTCATCGGAAGGGTATGTTACGGCGGCCGGGTTT TGGGGTACGGCTACGATATGGAAAGTTGGGTCGAAACTAAGTGCTCCTCTTGCATTGACGGTCGCCTGCGTCGTGCTCCGCCGCCGCCGCCGTTATCCAG GGGGGGGGGGGGGTGGAGGTGGCGGCGGGAGAAGAAATCCAGAAGAGTAAAGAAGATGATCACGAAGACGGTGACGAGCAACACAAGTCTAAAGTTGGCG GTGGGAATTAATTGA
AA sequence Show only first row Show all	>Lus10020993 pacid=23182411 polypeptide=Lus10020993 locus=Lus10020993.g ID=Lus10020993.BGIv1.0 annot-version=v1.0 MASVGAAIAAVAVITVLGVIACVIGRVCYGGRVLGYGYDMESWVETKCSSCIDGRLRRAPPPPPLSRGGGGWRWRREKKSRRVKKMITKTVTSNTSLKLA VGIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26520			unknown protein		Lus10020993 [exp]	0	1
AT5G51040			unknown protein		Lus10043024 [exp]	4.6	0.8057
AT4G37680		HHP4	heptahelical protein 4 (.1.2)		Lus10025206 [exp]	4.7	0.8048
AT2G02230		ATPP2-B1	phloem protein 2-B1 (.1)		Lus10029674 [exp]	6.3	0.7933
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10001479 [exp]	6.5	0.7986
AT3G01400			ARM repeat superfamily protein...		Lus10018685 [exp]	9.2	0.7930
AT4G18700		ATWL4, CIPK12, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10025397 [exp]	17.1	0.7857
AT2G27950			Ring/U-Box superfamily protein...		Lus10016162 [exp]	17.5	0.7563
AT1G64850			Calcium-binding EF hand family...		Lus10013613 [exp]	21.0	0.7634
AT2G46150			Late embryogenesis abundant (L...		Lus10017531 [exp]	21.5	0.7627
AT3G45010		SCPL48	serine carboxypeptidase-like 4...		Lus10037380 [exp]	22.4	0.7432

Compare expression of checked genes

Lus10020993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.