Lus10021002 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19000 369 / 3e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G19010 365 / 5e-126 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT3G55970 199 / 8e-61 ATJRG21 jasmonate-regulated gene 21 (.1)
AT5G05600 199 / 1e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10490 191 / 1e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10500 188 / 9e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G11180 189 / 2e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G38240 184 / 4e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G21420 180 / 2e-53 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 173 / 5e-51 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023850 387 / 9e-137 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10023851 376 / 4e-130 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10020999 370 / 1e-127 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004245 246 / 3e-80 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10030995 192 / 3e-58 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Lus10030934 187 / 4e-56 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1)
Lus10040112 186 / 8e-56 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1)
Lus10042155 180 / 3e-55 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10006518 184 / 7e-55 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G146000 484 / 2e-172 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G146100 472 / 1e-167 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G107600 399 / 3e-139 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G107550 395 / 8e-138 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G069300 197 / 3e-60 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101200 194 / 4e-59 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G188000 192 / 3e-58 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 190 / 3e-57 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101100 189 / 7e-57 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G023600 187 / 5e-56 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10021002 pacid=23182369 polypeptide=Lus10021002 locus=Lus10021002.g ID=Lus10021002.BGIv1.0 annot-version=v1.0
ATGGGAGAAGTTGATGCAGCATTCATCCAAGAAGCAGAGCACAGACCAAACCCAGAAATCATCAAAGCAGAAGGAATTCCTCTCATCGACCTCTCTCATG
CATCAACCGAGAGACTTGTGGGGGAGATCAGGGATGCTTGCAGGGAATGGGGGTTCTTCCAAGTGATCAACCATGGAGTTCCATTGGAGGCCAGACAGAG
AGTGGAGGCTGCTTCGAAGGAGTTCTTCTGGCAGCCATTGGAGGAGAAGAGGAAAGTTAGAAGAGATGAGAAGAAAGTTATGGGTTACTATGACACTGAG
CATACCAAGAACGTTAGGGATTGGAAAGAAGTGTTTGATTTCAGTGTTGAAGATCCTACTTTTGTTCCTCATGATGATCATGGTGGTGGTTTCTCTGAGT
GGCATAATCAGTGGCCTCAACATCCCTCTGATCTCAGGGAAGCATGCGAGGAGTATGCAAAAGAAGTGGAGAAGCTAGCCTACAAGGTGATGGAGCTGAT
CGCCATGAGCCTAGGGCTGGAACCAGACAGATTCCATGGATTCTTCGACGACCAATCGACCAGCTTCGTGAGGCTGAATCACTATCCTCCATGCCCAGTT
CCTCACTTGGCCCTCGGAGTCGGCCGGCACAAGGACGCCGGAGCACTCACCGTTCTTGCTCAGGACGACGTCGGCGGGCTGGAAGTGAAGAGGAGGTCCG
ATGGGGAGTGGGCCTGGGTCCAGCCCACTCCTGATGCTTACATTGTCAACGTTGGTGACATCATCCAGGTTTGGAGCAATGAGGCATACGAGAGCGTGGA
ACACAGAGTGATGGTGAACTCAGAGAAGGAAAGGTTCTCGATTCCGTTCTTCTTCAACCCATCCCATTACACTGTGGTTCAGCCATTGGAGGAACTACTG
GTGGTGGATGCTAGTAAGAAGAAGAAGAACACTACAGCAAAGTACAGGCCTTACCACTGGGGGAAGTTCTTTGTTACCAGGAAAGGCAGCAACTTCAAGA
AACTTGCTGTTGAAAACATCCAGATCTCTCACTTCAGAGTCCTCTCAGAAATCTGA
AA sequence
>Lus10021002 pacid=23182369 polypeptide=Lus10021002 locus=Lus10021002.g ID=Lus10021002.BGIv1.0 annot-version=v1.0
MGEVDAAFIQEAEHRPNPEIIKAEGIPLIDLSHASTERLVGEIRDACREWGFFQVINHGVPLEARQRVEAASKEFFWQPLEEKRKVRRDEKKVMGYYDTE
HTKNVRDWKEVFDFSVEDPTFVPHDDHGGGFSEWHNQWPQHPSDLREACEEYAKEVEKLAYKVMELIAMSLGLEPDRFHGFFDDQSTSFVRLNHYPPCPV
PHLALGVGRHKDAGALTVLAQDDVGGLEVKRRSDGEWAWVQPTPDAYIVNVGDIIQVWSNEAYESVEHRVMVNSEKERFSIPFFFNPSHYTVVQPLEELL
VVDASKKKKNTTAKYRPYHWGKFFVTRKGSNFKKLAVENIQISHFRVLSEI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19000 2-oxoglutarate (2OG) and Fe(II... Lus10021002 0 1
AT4G04830 ATMSRB5 methionine sulfoxide reductase... Lus10009574 6.7 0.9301
AT5G04590 SIR sulfite reductase (.1) Lus10009951 8.4 0.8867
AT1G13090 CYP71B28 "cytochrome P450, family 71, s... Lus10002670 28.1 0.8945
AT2G22620 Rhamnogalacturonate lyase fami... Lus10029552 30.0 0.8858
Lus10015147 34.7 0.8435
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10002324 39.9 0.8883
AT1G10370 GST30B, ATGSTU1... GLUTATHIONE S-TRANSFERASE U17,... Lus10013282 53.8 0.8464
AT1G03495 HXXXD-type acyl-transferase fa... Lus10029826 54.3 0.8539
AT3G22890 APS1 ATP sulfurylase 1 (.1) Lus10006629 62.9 0.8522
AT5G38200 Class I glutamine amidotransfe... Lus10016700 73.7 0.8496

Lus10021002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.