Lus10021004 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G23530 108 / 2e-28 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
AT4G37110 107 / 2e-28 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
AT1G67780 72 / 1e-15 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
AT5G38690 69 / 2e-14 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
AT1G67270 69 / 3e-14 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
AT1G11950 41 / 9e-05 Transcription factor jumonji (jmjC) domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023846 188 / 2e-60 AT2G23530 272 / 2e-87 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
Lus10019647 102 / 2e-26 AT2G23530 301 / 5e-97 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
Lus10000845 101 / 5e-26 AT2G23530 303 / 8e-98 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
Lus10033539 66 / 5e-13 AT5G38690 405 / 2e-134 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
Lus10017575 65 / 6e-13 AT5G38690 409 / 8e-137 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G108400 121 / 8e-34 AT2G23530 253 / 8e-79 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
Potri.007G036200 108 / 3e-28 AT2G23530 320 / 6e-102 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
Potri.006G257400 66 / 3e-13 AT5G38690 270 / 2e-81 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
Potri.018G024400 59 / 7e-11 AT5G38690 271 / 1e-81 Zinc-finger domain of monoamine-oxidase A repressor R1 protein (.1)
Potri.012G044400 56 / 6e-10 AT4G37110 96 / 2e-22 Zinc-finger domain of monoamine-oxidase A repressor R1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10497 zf-4CXXC_R1 Zinc-finger domain of monoamine-oxidase A repressor R1
Representative CDS sequence
>Lus10021004 pacid=23182361 polypeptide=Lus10021004 locus=Lus10021004.g ID=Lus10021004.BGIv1.0 annot-version=v1.0
ATGGTGTCGGCGACGAGGCGACGAAGAGCCGGAATCGGCGCTGCCACCGCCGGAGAAGAAGCAGTCGGTTCGAGTCCGGATCAACCTCCAGCATACGGAG
AGAATGTGGCCGAAGTGAACAAGAATCCAGATTGGATTTGCCCGACTTGCCGGGGAATCTGTAATTGCAGTCTTTGCAGGAAAGGAAAAGGTTGGTTACC
TACGGGCAATCTTTATAGGAAGGTTACTAAGCTCGGCTTCAAGTCCGTGGCACATTTTCTCATCCAAACCTGCCGTGCTAAGTCTACCCCAGAAGACTCA
CCTGCACCTGCTGAAGATCTCGTCCCTAAACTTCTCGATGCATCTGGTGAAGATGGTGAAGTCGGTACAGGAGACGGAGATGTCTCAATTGGCGATCATG
CTGCTGTTGACGAAGTGAAATAA
AA sequence
>Lus10021004 pacid=23182361 polypeptide=Lus10021004 locus=Lus10021004.g ID=Lus10021004.BGIv1.0 annot-version=v1.0
MVSATRRRRAGIGAATAGEEAVGSSPDQPPAYGENVAEVNKNPDWICPTCRGICNCSLCRKGKGWLPTGNLYRKVTKLGFKSVAHFLIQTCRAKSTPEDS
PAPAEDLVPKLLDASGEDGEVGTGDGDVSIGDHAAVDEVK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37110 Zinc-finger domain of monoamin... Lus10021004 0 1
AT3G56960 PIP5K4 phosphatidyl inositol monophos... Lus10010458 1.0 0.8180
AT4G02160 unknown protein Lus10010018 3.7 0.7912
AT5G58820 Subtilisin-like serine endopep... Lus10002245 3.7 0.7453
AT4G26830 O-Glycosyl hydrolases family 1... Lus10011852 8.4 0.7103
Lus10015336 10.1 0.7864
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10016437 10.1 0.7623
AT2G47770 ATTSPO TSPO(outer membrane tryptophan... Lus10037513 11.5 0.6589
Lus10027076 14.0 0.7704
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041976 15.0 0.7760
Lus10024012 16.2 0.7288

Lus10021004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.