Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15910 122 / 5e-38 CSL zinc finger domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023841 [exp] 132 / 4e-42 AT2G15910 123 / 1e-38 CSL zinc finger domain-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G109100 [exp] 123 / 2e-38 AT2G15910 137 / 5e-44 CSL zinc finger domain-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF05207 [flax] [poplar] zf-CSL CSL zinc finger
Representative CDS sequence Show only first row Show all	>Lus10021009 pacid=23182287 polypeptide=Lus10021009 locus=Lus10021009.g ID=Lus10021009.BGIv1.0 annot-version=v1.0 ATGTCGTACGACGACGTGGAGATAGAAGACATGGAGTGGAACGAGGAGCTACAATCGTACACGTACCCGTGCCCGTGCGGCGATCTGTTCCAGATAACAA AGGAGGATCTCCGAATCGGAGAGGAAATCGCTCGGTGTCCGAGCTGCTCCCTCTACATCACCGTCATATACAACCCGGAAGACTTCGACGAGTCGAAGGG GAAGAAGAAGAAGAGCGGCGGGAATAGCATCCAGCAACAACAGCAGACGGTCTCTGTTGCTTGA
AA sequence Show only first row Show all	>Lus10021009 pacid=23182287 polypeptide=Lus10021009 locus=Lus10021009.g ID=Lus10021009.BGIv1.0 annot-version=v1.0 MSYDDVEIEDMEWNEELQSYTYPCPCGDLFQITKEDLRIGEEIARCPSCSLYITVIYNPEDFDESKGKKKKSGGNSIQQQQQTVSVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15910			CSL zinc finger domain-contain...		Lus10021009 [exp]	0	1
AT1G71430			unknown protein		Lus10040114 [exp]	4.8	0.7672
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10024229 [exp]	5.5	0.7500
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10023599 [exp]	6.2	0.7658
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	6.3	0.7451
AT2G25830			YebC-related (.1)		Lus10038722 [exp]	7.3	0.7179
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10024942 [exp]	12.2	0.7388
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	13.2	0.7393
AT5G40080			Mitochondrial ribosomal protei...		Lus10034241 [exp]	16.0	0.6768
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10014426 [exp]	17.3	0.7208
AT5G40570			Surfeit locus protein 2 (SURF2...		Lus10003658 [exp]	18.7	0.6938

Compare expression of checked genes

Lus10021009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.