Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52980 66 / 2e-13 AtNug2 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1) AT3G07050 41 / 6e-05 NSN1 nucleostemin-like 1, GTP-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023835 [exp] 125 / 1e-34 AT1G52980 708 / 0.0 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1) Lus10018858 [exp] 43 / 2e-05 AT3G07050 622 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1) Lus10018881 [exp] 42 / 5e-05 AT3G07050 706 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1) Lus10028574 [exp] 40 / 0.0002 AT3G07050 743 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G402500 [exp] 88 / 3e-21 AT1G52980 811 / 0.0 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1) Potri.002G241100 [exp] 42 / 4e-05 AT3G07050 667 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021016 pacid=23182301 polypeptide=Lus10021016 locus=Lus10021016.g ID=Lus10021016.BGIv1.0 annot-version=v1.0 ATGGCGACTGCTGCAAAGATGATACTTCACGACTGGCAAAGGGGTAAAATCCCCTTTTTCGTACCACCTCCGCAACAGGATGAACAAAACCCATCAGAAG GAGAAGCTTTGGTGGAAGGTGCAGTAGCAGCAGATGAGGAGGGTGGTGGGGAGAGTAACAAAGCTGAATCTGCAGCTTTGAAAGCCATCGCCAATGTCAT TAACACTCAGCAACAAAGAAGTGTACCAGTCCAGAGGGATCTATTTAGTGAGAATGAGTTAAAGGGCGGTGGCGAGGAACAGCTCGAGGAGATTGATGAT GAAGAAGAAGAGACTGATGAAGAAGATGAAGATGAAGAAGAAGCTGCAACAGAAGGAGAAGCGGATGCCTGA
AA sequence Show only first row Show all	>Lus10021016 pacid=23182301 polypeptide=Lus10021016 locus=Lus10021016.g ID=Lus10021016.BGIv1.0 annot-version=v1.0 MATAAKMILHDWQRGKIPFFVPPPQQDEQNPSEGEALVEGAVAADEEGGGESNKAESAALKAIANVINTQQQRSVPVQRDLFSENELKGGGEEQLEEIDD EEEETDEEDEDEEEAATEGEADA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52980		AtNug2	nuclear/nucleolar GTPase 2, GT...		Lus10021016 [exp]	0	1
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10015146 [exp]	1.7	0.8050
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10026218 [exp]	1.7	0.7759
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10029171 [exp]	3.2	0.7647
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	5.3	0.7903
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	9.8	0.7429
AT5G62440			Protein of unknown function (D...		Lus10035009 [exp]	10.4	0.7521
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	15.0	0.7669
AT5G56940			Ribosomal protein S16 family p...		Lus10014281 [exp]	17.3	0.7186
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	19.1	0.7547
AT4G32175			PNAS-3 related (.1)		Lus10000238 [exp]	20.6	0.6091

Compare expression of checked genes

Lus10021016 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.