Lus10021025 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 216 / 2e-68 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52820 206 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 185 / 4e-56 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 183 / 2e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 177 / 3e-53 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 139 / 1e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 126 / 3e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 91 / 6e-21 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G14130 88 / 9e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005776 333 / 2e-114 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773 323 / 2e-110 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005774 241 / 4e-79 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016659 197 / 4e-61 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 184 / 1e-55 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027419 147 / 6e-44 AT1G52800 89 / 4e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041281 150 / 7e-44 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005516 150 / 3e-42 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008097 144 / 1e-40 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176500 220 / 7e-70 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176200 217 / 7e-69 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000 216 / 2e-68 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 176 / 6e-53 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400 176 / 9e-53 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 172 / 1e-50 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 162 / 1e-47 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 160 / 8e-47 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G159500 100 / 3e-24 AT4G23340 402 / 3e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.003G106900 95 / 3e-22 AT4G23340 392 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10021025 pacid=23182311 polypeptide=Lus10021025 locus=Lus10021025.g ID=Lus10021025.BGIv1.0 annot-version=v1.0
ATGGGGCACGCTACTATTCCGGTGATAGATCTCTCGAGTCTTGTGAAGCCGGAAACTGAGTCATGGGTTTCTACTCGGGCCGCGGTCAAATCGGCCATGG
AAGAGTACGGCTGTTTCCAGGCTACATACGACGTCGTCGTCGACCGAGAGGAGGTCGACAGTACTCCGATATTCAAGGCGATAGAAGAGCTGTTCGATCT
TCCCGAGGAGATTAAAATCCAAAACACCAGCACCAAGCCACTTTTCGGAAGCTCGGTGAGGAGCGATGCCAACCCGCTCTTCGAGACGCTTGCGATCGAT
AACCCGACTAGCGTCGAGGCCACTCGGAGCTTCACCAACCTCATGTGGCCGGCTGCCGGAAATGATGGCTTTAGCAAGACAAGTCTTTCAATATCAAAAA
GAATGGCGGAGCTACATGACAAGGTATTGAAGATGGTGAAGGAGAGCTACAACGTGGAGTTGGGGTTTCCAGACGATTCCATGAATTACTTACTTCGGTA
CTTGAAGTATCACACGCCACCGCTGAACCACTCCGACGTTGGTCTCCGTGCTCACTCCGACAAATCTTTTATTTCAGTCATCCATCAGAACCATCTCAAC
GGCCTGCAGATCCAACTTCCTGACGAGACACAGAGATGGGTTGACGTTGACCTTACGTCACCGCCGGCCGGGTCCTTCTTTGTTCTCGCCGGAGATGTTC
TCGTGGCATGGAGTAACGAAAGAATACGAAGCTGTGTGCACCGAGTGATAGTGCAAAGGGAGAAAGAAGACAGTAGGTATTGTGTGACACTGTTTAGTTA
TGTGGAGAGGGGGATCGAGATCCAGTCACCCGATGAGTTCGTGGACGAAGCTCATCCGTCGAAATACAGACCGTTCGATAACTTAGGATATCTTGATGAG
GTCCTAAAGAGCGTGATGATGAATCAGCCTATACTTACCATCAAGGACTACTGTGGGTTATAA
AA sequence
>Lus10021025 pacid=23182311 polypeptide=Lus10021025 locus=Lus10021025.g ID=Lus10021025.BGIv1.0 annot-version=v1.0
MGHATIPVIDLSSLVKPETESWVSTRAAVKSAMEEYGCFQATYDVVVDREEVDSTPIFKAIEELFDLPEEIKIQNTSTKPLFGSSVRSDANPLFETLAID
NPTSVEATRSFTNLMWPAAGNDGFSKTSLSISKRMAELHDKVLKMVKESYNVELGFPDDSMNYLLRYLKYHTPPLNHSDVGLRAHSDKSFISVIHQNHLN
GLQIQLPDETQRWVDVDLTSPPAGSFFVLAGDVLVAWSNERIRSCVHRVIVQREKEDSRYCVTLFSYVERGIEIQSPDEFVDEAHPSKYRPFDNLGYLDE
VLKSVMMNQPILTIKDYCGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10021025 0 1
AT3G01860 unknown protein Lus10041572 7.2 0.8078
AT2G25625 unknown protein Lus10008096 12.2 0.7811
AT2G25625 unknown protein Lus10013129 21.3 0.7857
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10029464 22.4 0.7253
AT1G01490 Heavy metal transport/detoxifi... Lus10024670 24.4 0.7728
AT5G02380 MT2B metallothionein 2B (.1) Lus10016546 28.7 0.7655
AT5G61340 unknown protein Lus10003483 29.4 0.7437
AT2G20680 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl ... Lus10018598 30.6 0.7721
AT4G24050 NAD(P)-binding Rossmann-fold s... Lus10017308 34.3 0.6653
Lus10029617 36.4 0.7508

Lus10021025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.