Lus10021027 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15930 191 / 1e-63 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT2G32060 191 / 1e-63 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027800 231 / 2e-79 AT2G32060 197 / 3e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Lus10023825 214 / 2e-71 AT2G32060 168 / 3e-53 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Lus10035501 220 / 5e-71 AT3G12150 333 / 3e-111 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G056200 225 / 5e-77 AT2G32060 201 / 9e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.005G206300 224 / 2e-76 AT2G32060 201 / 2e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.001G046600 212 / 7e-72 AT2G32060 194 / 8e-65 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Potri.003G181200 211 / 1e-71 AT2G32060 188 / 1e-62 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0101 PELOTA PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence
>Lus10021027 pacid=23182387 polypeptide=Lus10021027 locus=Lus10021027.g ID=Lus10021027.BGIv1.0 annot-version=v1.0
ATGTCAGGTGAAGAGGTTGCTGTTCAACAGCCAGAGGCTGCCCCTGCCGCTGCCCCAGCAGCTGCTTTGGGTGAGCCGATGGACTTGATGACTGCGTTGC
AGCTTGTTCTGAGGAAGGCACTTGCTCACGGTGGTCTTGTAAAAGGGCTTCACGAAGGTGCTAAAGTGATCGAGAAGCACACTGCTCAGCTTTGTGTATT
GGCAGAGGACTGCAACCAGGCTGACTATGTTAAGTTGGTGAAAGCTCTCTGTGCTGATCACAATGTTAACTTGATGACTGTTCCCAGCGCCAAGACCCTC
GGTGAATGGGCAGGGCTATGCAAGATCGATTCGGAAGGGAAAGCGAGGAAGGTTGTGGGAGCCTCCATGGTCGTTGTTAAGGATTTCGGTGAGGAAAGTG
AAGGACTTAACATTGTCCAAGAACATCTGAAATCTCAATAG
AA sequence
>Lus10021027 pacid=23182387 polypeptide=Lus10021027 locus=Lus10021027.g ID=Lus10021027.BGIv1.0 annot-version=v1.0
MSGEEVAVQQPEAAPAAAPAAALGEPMDLMTALQLVLRKALAHGGLVKGLHEGAKVIEKHTAQLCVLAEDCNQADYVKLVKALCADHNVNLMTVPSAKTL
GEWAGLCKIDSEGKARKVVGASMVVVKDFGEESEGLNIVQEHLKSQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10021027 0 1
AT5G60670 Ribosomal protein L11 family p... Lus10015085 1.0 0.9066
AT2G29530 TIM10 Tim10/DDP family zinc finger p... Lus10016453 3.0 0.8972
AT4G15000 Ribosomal L27e protein family ... Lus10003814 6.6 0.9044
AT5G52470 ATFIB1, ATFBR1,... SKP1/ASK1-INTERACTING PROTEIN,... Lus10014969 9.2 0.8551
AT4G25740 RNA binding Plectin/S10 domain... Lus10039282 9.5 0.8673
AT5G59850 Ribosomal protein S8 family pr... Lus10023429 16.6 0.8820
AT5G40770 ATPHB3 prohibitin 3 (.1) Lus10014604 18.8 0.8743
AT3G56070 ROC2 rotamase cyclophilin 2 (.1.2) Lus10042553 19.9 0.8444
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10009322 19.9 0.8369
AT3G06040 Ribosomal protein L12/ ATP-dep... Lus10031756 21.0 0.8391

Lus10021027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.