Lus10021032 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42220 305 / 6e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT3G08920 111 / 7e-30 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 83 / 1e-18 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G27700 53 / 3e-08 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G17850 47 / 2e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66040 45 / 3e-06 STR16 sulfurtransferase protein 16 (.1.2)
AT5G66170 45 / 4e-06 STR18 sulfurtransferase 18 (.1.2.3)
AT2G21045 40 / 0.0003 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G35770 40 / 0.0004 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023820 467 / 2e-169 AT2G42220 302 / 1e-104 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10004811 95 / 2e-23 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10002485 94 / 3e-23 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10043306 89 / 1e-20 AT4G24750 389 / 3e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10019454 88 / 2e-20 AT4G24750 390 / 2e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10012566 54 / 4e-09 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10005635 54 / 9e-09 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10023243 49 / 1e-06 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10028390 47 / 3e-06 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G059200 354 / 3e-125 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G100600 97 / 2e-24 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G086100 84 / 3e-19 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G111200 53 / 9e-09 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 48 / 5e-07 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G106400 45 / 2e-05 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.012G020700 44 / 3e-05 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G008000 44 / 3e-05 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10021032 pacid=23182288 polypeptide=Lus10021032 locus=Lus10021032.g ID=Lus10021032.BGIv1.0 annot-version=v1.0
ATGGCTGGTCTTGCTGCTTCTTGTTCCACCCTTTCTTCCAGAAGAAATTTTGCGGCATCTTGGTTGGAATTCCAGGCTGACGGAGATCATCAACACGGAA
GAACGCGATGGAGACAGATTCCTCGATGTGTAAAGACGTTTGGGATAAGAGCTGAGGTGAATTATGTGAGGGCGGAGGAAGCCAAAAAGCTGATAGCAGA
AGAAGGGTATGCAGTAGTTGATGTGAGGGACGTGAGACAATTCGAGCGAGCGCATATCAAATCGTGCTACCATGTTCCTCTCTTCATCGAAAACAAAGAC
AACGACATTGGGACCATCATTAATAGGCAACTGCACAACAACTTCTCCGGGTTGTTCTATGGGCTGCCTTTCACTAAGCCAAATCCTGAGTTTGTAGAGT
CGGTGAAGAGCAAGTTCTCGCCCGAAAGCAAACTGTTGGTGGTGTGCCAGGAAGGACTGAGGTCTGCCGCAGCAGCTGACAAGCTAGAGAAAGCCGGTTT
CCAGAACATTGCATGCATAACATCTGGTCTCCAATCTGTTAAACCAGGTACATTCGATTCCGAAGGCAAAACCGAGTTACAAAATGCTGGCAAAGCCGGT
TTGGTCACAGTTCAAGGCAAGATCTCCGCTGTCGTTGGAACCATTCTCGTCTGCGCACTTCTATTCATTACGATCTTTCCTGATCAAGCGGAGCAGCTGT
TAGCACTAGTACCATCTAGCTAG
AA sequence
>Lus10021032 pacid=23182288 polypeptide=Lus10021032 locus=Lus10021032.g ID=Lus10021032.BGIv1.0 annot-version=v1.0
MAGLAASCSTLSSRRNFAASWLEFQADGDHQHGRTRWRQIPRCVKTFGIRAEVNYVRAEEAKKLIAEEGYAVVDVRDVRQFERAHIKSCYHVPLFIENKD
NDIGTIINRQLHNNFSGLFYGLPFTKPNPEFVESVKSKFSPESKLLVVCQEGLRSAAAADKLEKAGFQNIACITSGLQSVKPGTFDSEGKTELQNAGKAG
LVTVQGKISAVVGTILVCALLFITIFPDQAEQLLALVPSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42220 Rhodanese/Cell cycle control p... Lus10021032 0 1
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10035864 2.2 0.9850
AT4G09040 RNA-binding (RRM/RBD/RNP motif... Lus10041138 2.6 0.9668
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10002084 3.5 0.9806
AT2G42220 Rhodanese/Cell cycle control p... Lus10023820 4.5 0.9765
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10025798 5.2 0.9766
AT1G55670 PSAG photosystem I subunit G (.1) Lus10041966 5.7 0.9663
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10002712 6.3 0.9504
AT1G22130 MADS AGL104 AGAMOUS-like 104 (.1) Lus10022505 6.5 0.9570
AT2G20260 PSAE-2 photosystem I subunit E-2 (.1) Lus10011913 7.4 0.9747
AT1G30380 PSAK photosystem I subunit K (.1) Lus10007399 8.1 0.9673

Lus10021032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.