Lus10021048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12120 245 / 2e-81 FAD2 fatty acid desaturase 2 (.1.2)
AT3G11170 98 / 3e-24 AtFAD7, FADD, FAD7 FATTY ACID DESATURASE D, fatty acid desaturase 7 (.1)
AT5G05580 95 / 2e-23 AtFAD8, SH1, FAD8 fatty acid desaturase 8 (.1.2)
AT2G29980 92 / 3e-22 AtFAD3, FAD3 fatty acid desaturase 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004178 348 / 9e-122 AT3G12120 532 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004175 275 / 4e-93 AT3G12120 635 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021051 275 / 6e-93 AT3G12120 634 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021050 268 / 5e-90 AT3G12120 521 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004176 265 / 5e-89 AT3G12120 519 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10004177 259 / 7e-87 AT3G12120 508 / 0.0 fatty acid desaturase 2 (.1.2)
Lus10021049 254 / 8e-85 AT3G12120 503 / 4e-179 fatty acid desaturase 2 (.1.2)
Lus10012007 244 / 8e-84 AT3G12120 266 / 8e-90 fatty acid desaturase 2 (.1.2)
Lus10029283 244 / 8e-84 AT3G12120 266 / 8e-90 fatty acid desaturase 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G046200 259 / 9e-87 AT3G12120 624 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.006G192000 251 / 2e-83 AT3G12120 629 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012401 252 / 3e-83 AT3G12120 571 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012700 236 / 1e-77 AT3G12120 553 / 0.0 fatty acid desaturase 2 (.1.2)
Potri.001G012500 183 / 1e-57 AT3G12120 480 / 3e-171 fatty acid desaturase 2 (.1.2)
Potri.008G069600 99 / 2e-24 AT5G05580 689 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.010G187800 97 / 9e-24 AT5G05580 683 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.006G101500 96 / 1e-23 AT5G05580 632 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.016G117500 95 / 3e-23 AT5G05580 592 / 0.0 fatty acid desaturase 8 (.1.2)
Potri.001G252900 92 / 2e-22 AT2G29980 539 / 0.0 fatty acid desaturase 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00487 FA_desaturase Fatty acid desaturase
Representative CDS sequence
>Lus10021048 pacid=23182339 polypeptide=Lus10021048 locus=Lus10021048.g ID=Lus10021048.BGIv1.0 annot-version=v1.0
ATGTCCCCTATTTACAGCGACCGCGAGCGAGCCGAGGTATTCGCCTCAGATGTTGGCTTGCTCGCTGTCTGCTTCGCGTTGTACAAACTTATTATGGTCA
AGGGAATGGCGTGGGTTTTTTGCGTCTATGGGGCTCCGGTCATGGTGGTGAATGGATTCTTCATTACCATCACTTACTTGCATCACACTCATCTCGCGGT
CCCGCGATACGATTCGTCTGAATGGGATTGGTTGAGGGGAGCCCTGGCAACCATGGACAGGGACTTTGGCCTTTTGAACAAGGTGTTCCATAATGTTACA
GATACTCACGTGACGCACCATCTGATTTCGACGATCCCTCATTATCATGCCATGGAAGCCAACAACGCAATTAGGCCCGTGTTGGGGGACTACTACCATA
TCGACAGGACGCCGGTGGTTAAGGCGTTGTGGAGGGAGGCTAAGGAGTGTGTTTACATCGAGGCCGATGATGGTGAAAAGAACAAAGGCGTGTTCTGGTT
CAATACCAAGCTCTAA
AA sequence
>Lus10021048 pacid=23182339 polypeptide=Lus10021048 locus=Lus10021048.g ID=Lus10021048.BGIv1.0 annot-version=v1.0
MSPIYSDRERAEVFASDVGLLAVCFALYKLIMVKGMAWVFCVYGAPVMVVNGFFITITYLHHTHLAVPRYDSSEWDWLRGALATMDRDFGLLNKVFHNVT
DTHVTHHLISTIPHYHAMEANNAIRPVLGDYYHIDRTPVVKALWREAKECVYIEADDGEKNKGVFWFNTKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021048 0 1
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021049 1.0 0.9379
Lus10014855 2.0 0.8357
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10001460 4.9 0.8124
AT4G31980 unknown protein Lus10038338 6.9 0.7797
AT4G01470 ATTIP1.3, GAMMA... tonoplast intrinsic protein 1;... Lus10005885 6.9 0.8600
AT3G08030 Protein of unknown function, D... Lus10029503 10.3 0.8636
AT1G29970 RPL18AA 60S ribosomal protein L18A-1 (... Lus10005572 14.1 0.8160
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10042214 19.1 0.8119
AT1G04170 EIF2 GAMMA, EIF... eukaryotic translation initiat... Lus10020312 25.6 0.7632
Lus10030676 28.6 0.8206

Lus10021048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.