Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39235 107 / 3e-32 unknown protein AT3G05570 105 / 2e-31 unknown protein AT2G21640 78 / 4e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004160 [exp] 144 / 2e-46 AT4G39235 109 / 4e-33 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G155500 [exp] 110 / 5e-33 AT4G39235 120 / 2e-37 unknown protein Potri.002G057100 [exp] 107 / 5e-32 AT4G39235 122 / 3e-38 unknown protein Potri.005G205500 [exp] 90 / 4e-25 AT4G39235 106 / 1e-31 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021065 pacid=23182441 polypeptide=Lus10021065 locus=Lus10021065.g ID=Lus10021065.BGIv1.0 annot-version=v1.0 ATGGAGGCATCAAAAGGGTCAGAGGAAAAGCAGCAACAGGAGCAACCAAAGCCAGTAGAATCATGCCGCAAGTACAAGAAGGACGACGCCAGTTTTCTGG AAGATGTGAAAGACCACATCGACGAATTCATTAACGCATCGATGGACGAGCATAAGTCGTGCTTTAAGAAAACCATCAATAAGATGTTTAGCATGTCAAG GATCGTTTCGAAGAAGCAAGACGAAGCTGAAGGTGTCGAAAGTGTTCTCCCCCTTCAAACTACTGTGTCTAAATGA
AA sequence Show only first row Show all	>Lus10021065 pacid=23182441 polypeptide=Lus10021065 locus=Lus10021065.g ID=Lus10021065.BGIv1.0 annot-version=v1.0 MEASKGSEEKQQQEQPKPVESCRKYKKDDASFLEDVKDHIDEFINASMDEHKSCFKKTINKMFSMSRIVSKKQDEAEGVESVLPLQTTVSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39235			unknown protein		Lus10021065 [exp]	0	1
AT1G25682			Family of unknown function (DU...		Lus10034268 [exp]	3.5	0.8711
AT1G01490			Heavy metal transport/detoxifi...		Lus10036395 [exp]	7.4	0.8819
AT3G14430			unknown protein		Lus10002683 [exp]	7.5	0.8309
AT5G62200			Embryo-specific protein 3, (AT...		Lus10027387 [exp]	7.7	0.8602
AT3G05010			Protein of unknown function, t...		Lus10018985 [exp]	9.2	0.8685
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10023188 [exp]	10.5	0.8439
AT1G56423			unknown protein		Lus10020695 [exp]	12.3	0.8495
AT1G30090			Galactose oxidase/kelch repeat...		Lus10028121 [exp]	13.4	0.8669
AT5G57860			Ubiquitin-like superfamily pro...		Lus10035816 [exp]	14.0	0.8374
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10035184 [exp]	16.3	0.8556

Compare expression of checked genes

Lus10021065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.